Pseudomonas tritici: HU722_0003100 Help Entry HU722_0003100     CDS       T07594                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptrt  Pseudomonas tritici Pathway ptrt01100   Metabolic pathways ptrt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptrt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU722_0003100    00074 Mycolic acid biosynthesis     HU722_0003100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU722_0003100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXH84490 UniProt:  A0A8H9YMI5 LinkDB All DBs Position complement(718254..718523) Genome browser AA seq 89 aa AA seqDB search MSDRHRLEHDIKMLIIEALGLEDISVDDIGSEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAYVTDRQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgacagacaccgccttgagcacgacataaagatgctgatcatcgaggcactgggc ctggaagacatcagcgtcgacgacatcggtagcgagcaaaccctgttcggcgaaggcctt ggcctggattcggtagacgccctggaattgggcctggcgatccagaaaaagtacggcatc aagatcgatgccgacgccaaggacacccgtaatcacttcaccaacgtggccagccttgcg gcgtacgtcacggacagacaggcagcttga

DBGET integrated database retrieval system