Paraburkholderia terricola: CUJ90_18205 Help Entry CUJ90_18205       CDS       T05812                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pts  Paraburkholderia terricola Brite KEGG Orthology (KO) [BR:pts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pts03032]     CUJ90_18205    03036 Chromosome and associated proteins [BR:pts03036]     CUJ90_18205    03400 DNA repair and recombination proteins [BR:pts03400]     CUJ90_18205 DNA replication proteins [BR:pts03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CUJ90_18205 Chromosome and associated proteins [BR:pts03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CUJ90_18205 DNA repair and recombination proteins [BR:pts03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CUJ90_18205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AXE94046 LinkDB All DBs Position mHS1_A:4014682..4014960 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKSVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgcaggacagacgggcgccagcaaggctcaa accggtgagacgctggacacgttgcttgaagtgatcaagaagtccgtgtcgaagggcgac gcggtccagttgatcggcttcggcagctttggttcgggcaagcgcgcagcacgtacgggt cgtaatcccaagaccggcgagaccatcaagatcccggcagccaagaccgtcaagttcacg gctggcaaggcgttcaaggacgcagtcaacaagcgctaa

DBGET integrated database retrieval system