Paraburkholderia terricola: CUJ90_24735 Help Entry CUJ90_24735       CDS       T05812                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism pts  Paraburkholderia terricola Brite KEGG Orthology (KO) [BR:pts00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pts03036]     CUJ90_24735    03400 DNA repair and recombination proteins [BR:pts03400]     CUJ90_24735 Chromosome and associated proteins [BR:pts03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CUJ90_24735 DNA repair and recombination proteins [BR:pts03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       CUJ90_24735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AXE95518 UniProt:  A0A1M6NAG2 LinkDB All DBs Position mHS1_B:1381366..1381629 Genome browser AA seq 87 aa AA seqDB search MKEREEQRLFDLDGNARERLILWIRRRMDEYGITTEALAEAIEADAAKTRAVMYRDAFGN TWDGHGDKPDWLARAIYAGQNIDHFRC NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaagagcgagaagaacaaaggctgttcgacctcgacgggaatgcgcgtgagcgcttg atcctgtggatacgccgacgcatggacgaatacggcattacgacggaagcgctagccgag gcgatcgaggccgacgcagccaagacgcgagccgtgatgtatcgcgacgccttcggcaat acgtgggacggtcacggcgacaagccggactggctcgcgcgcgcgatttacgctgggcag aacatcgatcacttccgttgttga

DBGET integrated database retrieval system