Photorhabdus thracensis: VY86_09545 Help Entry VY86_09545        CDS       T03944                                  Name (GenBank) tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ptt  Photorhabdus thracensis Pathway ptt00362   Benzoate degradation ptt01100   Metabolic pathways ptt01120   Microbial metabolism in diverse environments ptt01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ptt00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     VY86_09545    00622 Xylene degradation     VY86_09545    00621 Dioxin degradation     VY86_09545 Enzymes [BR:ptt01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      VY86_09545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 CinA_KH Motif Other DBs NCBI-ProteinID:  AKH63543 UniProt:  A0A0F7LNJ1 LinkDB All DBs Position complement(2222559..2222765) Genome browser AA seq 68 aa AA seqDB search MPFVNIRITREGATAEQKKQLIEGATQLLADVLGKNPATTFVIIDEVDTDNWGIGGKNVT ELRAEAKK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccgtttgttaatatcagaattacccgtgaaggtgctacagcagaacaaaagaagcaa ttaattgaaggtgctactcagttactggccgatgtattgggaaaaaatccggcgacaact tttgtcattattgatgaagtcgatactgataattggggaatcggcggtaagaatgtgact gaacttagagctgaggctaaaaagtag

DBGET integrated database retrieval system