Photorhabdus thracensis: VY86_12815 Help Entry VY86_12815        CDS       T03944                                  Symbol groES Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism ptt  Photorhabdus thracensis Brite KEGG Orthology (KO) [BR:ptt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ptt03110]     VY86_12815 (groES)    03029 Mitochondrial biogenesis [BR:ptt03029]     VY86_12815 (groES) Chaperones and folding catalysts [BR:ptt03110]  Heat shock proteins   HSP10    VY86_12815 (groES) Mitochondrial biogenesis [BR:ptt03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     VY86_12815 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AKH64072 UniProt:  A0A0F7LQJ8 LinkDB All DBs Position 2935801..2936094 Genome browser AA seq 97 aa AA seqDB search MNIRPLHDRVIVKRKEVESKSAGGIVLTGTAAGKSTRGEVLAVGNGRILESGDVKALCVK VGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaatattcgtccattgcatgatcgtgtaatcgtcaagcgcaaagaagttgaatcaaaa tctgctggcggtattgtgctgactggcactgctgcgggtaaatctactcgtggtgaagtt ttggctgtgggcaatggccgcatccttgaaagcggtgatgtaaaagcactgtgtgtgaaa gttggagatattgttatttttaacgatggttacggtgttaagtcagagaagatcgacaac gaagaagtgttgatcatgtctgaaagcgacattctggcaattgttgaagcgtaa

DBGET integrated database retrieval system