Photorhabdus thracensis: VY86_20180 Help Entry VY86_20180        CDS       T03944                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptt  Photorhabdus thracensis Pathway ptt01100   Metabolic pathways ptt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VY86_20180    00074 Mycolic acid biosynthesis     VY86_20180   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VY86_20180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 PHA-1 Motif Other DBs NCBI-ProteinID:  AKH65324 UniProt:  A0A0F7LQ12 LinkDB All DBs Position complement(4626884..4627126) Genome browser AA seq 80 aa AA seqDB search MENLENHVKNVVAEQLGIPEAQILTTQTFEELGADSLDSVELIMALEERFEITIDDTEAE KMVTVQNAIDCIRLKLESAD NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtggaaaatttagagaatcatgttaaaaatgttgttgcagaacaacttggaatacccgaa gcccagattcttactacacaaacattcgaggaattgggtgccgattcgttagatagtgtc gagttgattatggctctggaagaacgtttcgagataactattgacgatacagaggcagaa aaaatggtgacggtacaaaacgccattgattgtatccgtttgaagttagaatcagccgac tga

DBGET integrated database retrieval system