Pseudomonas trivialis: AA957_11900 Help Entry AA957_11900       CDS       T04006                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptv  Pseudomonas trivialis Pathway ptv01100   Metabolic pathways ptv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AA957_11900    00074 Mycolic acid biosynthesis     AA957_11900   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AA957_11900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Motif Other DBs NCBI-ProteinID:  AKS06789 UniProt:  A0A0H5A6Z5 LinkDB All DBs Position 2671041..2671295 Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELPPERVTLDANLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKAVRTVNDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgatatcttcaacaccttgcgcgatgccttggtggaactgtttgaa ctgccgccagaacgcgtcacccttgacgccaacctgtaccaggacctggaaatcgacagc atcgacgccgtcgatttgatcgaccatatcaagcgccagaccggcaagaagatcgccgcc gaggaattcaaggcggtacggactgtgaacgacgtggttgaggcggtgtaccgtctggtc cagccggccgcatga

DBGET integrated database retrieval system