Pseudomonas tohonis: TUM18999_55830 Help Entry TUM18999_55830    CDS       T07887                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptw  Pseudomonas tohonis Pathway ptw01100   Metabolic pathways ptw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TUM18999_55830    00074 Mycolic acid biosynthesis     TUM18999_55830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TUM18999_55830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCG27392 UniProt:  A0A6J4ECB9 LinkDB All DBs Position 6116222..6116482 Genome browser AA seq 86 aa AA seqDB search MSALQLEIKNLIIEALGLEDIGPDDIDAEQTLFGEGLGLDSVDALELGLAIQKRFGIKID ADAKDTRKHFANVASLAAFVSAQKAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgctctgcaacttgagatcaagaacctgatcatcgaggccctgggcctcgaagac atcggccccgacgacatcgacgccgaacagaccctgttcggcgaaggcctgggcctggac tcggtggacgccctggaactgggcctggccatccagaagcgcttcggcatcaagatcgac gccgatgccaaggacacccgcaaacactttgccaacgtggccagcctcgcggccttcgtc tcggcacagaaagccgcctga

DBGET integrated database retrieval system