Pseudomonas tohonis: TUM18999_55840 Help Entry TUM18999_55840    CDS       T07887                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptw  Pseudomonas tohonis Pathway ptw01100   Metabolic pathways ptw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TUM18999_55840    00074 Mycolic acid biosynthesis     TUM18999_55840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TUM18999_55840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  BCG27393 UniProt:  A0A6J4EBV9 LinkDB All DBs Position 6116496..6116750 Genome browser AA seq 84 aa AA seqDB search MQTRDEIFTTLRDALVELFELDPAQISLESNLYEDLEIDSIDAVDLIDHIKRHTGRKIAA EDFKAVRTVSDVVEAVHRLVNEPA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgacgagatcttcaccaccctgcgcgacgccctggtcgaactcttcgag ctggacccggcgcagatcagcctggaatccaacctctacgaggacctggagatcgacagc atcgacgccgtcgacctgatcgaccacatcaagcgccacaccggccgcaagatcgccgcc gaggacttcaaggccgtgcgcaccgtcagcgacgtggtcgaggccgtgcaccgcctggtg aacgagcccgcatga

DBGET integrated database retrieval system