Pandoraea thiooxydans: ABW99_06380 Help Entry ABW99_06380       CDS       T03947                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ptx  Pandoraea thiooxydans Pathway ptx01100   Metabolic pathways ptx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABW99_06380    00074 Mycolic acid biosynthesis     ABW99_06380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABW99_06380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKJ67900 UniProt:  A0A0G3ELT4 LinkDB All DBs Position 2183451..2183720 Genome browser AA seq 89 aa AA seqDB search MITTPTKIESELATLIIEGLNLDIDREHIDPDGPIFGEGLGLDSIDALELGMLLSSTYHV TITPGDKKNDEIFKSLRSLGQYVEQHRQA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgataaccacgcccacgaaaatcgaaagcgagctcgccaccttgatcatcgagggactc aacctcgatatcgatcgtgaacacatcgatcccgatggaccgattttcggcgaaggcctg ggcctggattcgatcgatgccctcgagttgggcatgctgctctcatcgacttaccacgtg accatcacgccgggcgataaaaagaacgacgagattttcaaatcgcttcgatcgctcgga cagtatgtcgaacagcaccggcaggcgtga

DBGET integrated database retrieval system