Pandoraea thiooxydans: ABW99_06510 Help Entry ABW99_06510       CDS       T03947                                  Name (GenBank) hypothetical protein   KO K20976   histidine phosphotransfer protein HptB Organism ptx  Pandoraea thiooxydans Pathway ptx02020   Two-component system Brite KEGG Orthology (KO) [BR:ptx00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ABW99_06510  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02022 Two-component system [BR:ptx02022]     ABW99_06510 Two-component system [BR:ptx02022]  Other families   SagS-HptB-HsbR (swarming activity and biofilm formation)    ABW99_06510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hpt DUF3829_2nd Motif Other DBs NCBI-ProteinID:  AKJ67922 UniProt:  A0A0G3ERJ9 LinkDB All DBs Position 2203639..2203875 Genome browser AA seq 78 aa AA seqDB search MQADLRALEAALSQGDRCALLTRLHRMKGAFAALGERTLADRCHAFETLAQQASTAQWPA AYEAFSAQVRGFLKQWQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcaagctgatctgcgtgcactcgaggcggccttgtcgcagggcgatcgctgcgcgctg ctcaccaggctgcaccgcatgaagggtgcgttcgccgcgttgggcgagcgtacgctggca gatcgctgccatgccttcgagacgcttgcgcagcaagcttcaaccgcgcagtggcccgca gcctatgaagcctttagcgcacaggtgcggggttttctgaagcagtggcaatcgtga

DBGET integrated database retrieval system