Pandoraea thiooxydans: ABW99_12745 Help Entry ABW99_12745       CDS       T03947                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptx  Pandoraea thiooxydans Pathway ptx01100   Metabolic pathways ptx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABW99_12745    00074 Mycolic acid biosynthesis     ABW99_12745   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABW99_12745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AKJ68943 UniProt:  A0A0G3EPG5 LinkDB All DBs Position complement(3599283..3599522) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYATKHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacattgagcaacgcgtcaaaaagatcgtggcggagcaacttggcgttgccgaa gcagaaatcaagaacgaatcttcgttcgtcaacgatctcggcgcagactcgctcgatacc gttgagttggtgatggccctcgaagacgagttcggcatggaaattcccgacgaggaagcc gagaagatcaccacggtgcaacaggcgatcgattacgccaccaagcacgtcaaagcgtaa

DBGET integrated database retrieval system