Pandoraea thiooxydans: ABW99_21015 Help Entry ABW99_21015       CDS       T03947                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ptx  Pandoraea thiooxydans Pathway ptx00190   Oxidative phosphorylation ptx01100   Metabolic pathways ptx02020   Two-component system Module ptx_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ptx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ABW99_21015  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ABW99_21015 Enzymes [BR:ptx01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ABW99_21015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB 2TM Motif Other DBs NCBI-ProteinID:  APD30433 LinkDB All DBs Position 3966676..3966798 Genome browser AA seq 40 aa AA seqDB search MWYFTWILGVGVALAFGIINVMWLEAHEDFERREQDGNAS NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctggattttgggcgtcggtgtcgccctggcctttggcatcatcaat gtcatgtggctggaggcccatgaagactttgagcgccgcgagcaggacggcaacgcaagc tga

DBGET integrated database retrieval system