Ectopseudomonas toyotomiensis: JWV26_13595 Help Entry JWV26_13595       CDS       T07285                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pty  Ectopseudomonas toyotomiensis Pathway pty01100   Metabolic pathways pty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pty00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JWV26_13595    00074 Mycolic acid biosynthesis     JWV26_13595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JWV26_13595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QSL90811 LinkDB All DBs Position complement(2946908..2947168) Genome browser AA seq 86 aa AA seqDB search MSDLQLEIKNLIIDALGLEDMSADDIGAEQTLFGEGLGLDSVDALELGLAIQKRFGIKID AEAKDTRKHFANVASLAAFVSAQKAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaacttgaaatcaagaacctgatcatcgatgccctcggcctcgaggac atgagtgccgatgacattggcgcggagcagactctgtttggcgaagggctcggcctggac tcggtggacgcactcgagctggggctggcaatccagaagcgtttcggtatcaagatcgac gctgaagccaaggacacgcgcaagcacttcgccaacgtcgcgagcctggctgcgttcgtt tccgcccagaaagctgcttga

DBGET integrated database retrieval system