Pseudomonas tensinigenes: HU718_001195
Help
Entry
HU718_001195 CDS
T07620
Name
(GenBank) SulP family inorganic anion transporter
KO
K03321
sulfate permease, SulP family
Organism
ptz
Pseudomonas tensinigenes
Brite
KEGG Orthology (KO) [BR:
ptz00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ptz02000
]
HU718_001195
Transporters [BR:
ptz02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
HU718_001195
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
STAS_2
SAM_GIDA_C
Motif
Other DBs
NCBI-ProteinID:
QXI06340
UniProt:
A0ABX8PY72
LinkDB
All DBs
Position
complement(264864..266432)
Genome browser
AA seq
522 aa
AA seq
DB search
MAFPSRHSLLPFLTWLPRQTRASVGRDLIVGLSGAILALPQSIAYALIAGLPPEYGLYAA
IIPVLIACLWGSSWHLICGPTAAISIVLFASVSPLAVPASQDYITLILLLTLLAGIFQWL
LGLLRFGALVNFVSHSVVLGFTLGAAVVIAIGQLPNLLGLELPAKATALASLMDLLHHLR
AVDKPSLVLGVATVVVGVVLKQLLPRWPTLLITLALASLLVWLWPAMFGHVHLVSAFVGR
LPPFSALPLDLDLILRLLPSAVAVGMLGLVTSLSIARSISARSQQLLDANQEVRAQGLSN
IVGAFFSGSLSAGSFTRSGLSYEAGACSPLAGVFSAIWVALFAIFGAGLIAHIPIPAMAG
SILLIAWGLVDHRGIRALLRVSRAEFVVMALTCLATLLLELQTAIYAGVLASLFFYLKRT
SQPRVQHWRDGEDDVLRVGGSIFFGASHYLQVRLQRLHGARVVIEAQQINFIDYSGVEML
HQEARRLLRQNRSLTLRRARPQVVEELRKLEGPEKCPIRFED
NT seq
1569 nt
NT seq
+upstream
nt +downstream
nt
atggccttccccagccgccactctctcttgcccttcctcacctggctaccgcggcaaacc
cgcgccagtgtcggacgggatctgatcgtcggcctcagcggtgcgattctcgcgttaccc
cagtcgatcgcctacgcgctgatcgccggtctgccacctgaatatggcctctacgccgca
atcatcccggtgctgattgcctgcctgtggggttcgtcgtggcatttgatctgtggcccg
acggcagccatttcgatcgtgctgtttgccagcgtcagtcccttagcggtcccggcgtcg
caggactacatcaccctgatcttgttgctgaccttgcttgccggaattttccaatggctg
ctcggcctgctgcgcttcggtgcgctggtgaatttcgtttcgcattcagtggtgctgggg
ttcactcttggcgcggcggtggtgatcgccatcgggcagttgccgaatctgttggggctg
gagttgccggccaaagccacggcgctggcgagtctgatggatctgctgcatcacctcagg
gctgtggataaaccttcgttggtactcggtgtggcgacggtggttgtcggtgtggtgttg
aaacaattgctgccgcgctggccgacgctgttgataaccctcgctttggccagcctgctg
gtgtggctgtggccggcgatgttcggccatgtgcatctggtcagcgcgtttgtcgggcgg
ttaccgccgttcagtgcgttgccgctggatctcgatttgatcttgcgcctgctgccgagc
gccgtcgcagtgggcatgctcggactggtcaccagtctgtcgattgcccgctcgatttcg
gcgcggtcgcaacagttgctcgatgccaatcaggaagtccgcgcgcagggtttatcgaat
attgtcggggcgttcttttccggatcgttgtcggcaggctcgtttactcgctcgggattg
agttatgaggcgggcgcttgctcaccactggccggggtgttttcggcgatctgggtcgcg
ctgttcgcgatatttggcgccgggctgatcgcgcacattccgatcccggcgatggccggg
agcattctgctgattgcctggggactggtggatcaccgcggcattcgtgccttgttgcgg
gttagccgcgccgagttcgtggtcatggccctgacgtgtctggcgacgttgctgctggag
ttgcagacggcgatttatgccggtgtgctggcctcgctgttcttctatctcaagcgcacc
tcgcaaccgcgcgtgcagcattggcgcgacggcgaggacgatgtgttgcgcgtcggcggc
tcgatctttttcggcgccagccattatcttcaggtgcgtctgcaacgcctgcacggcgcg
cgagtggtgatcgaggcgcagcagatcaacttcatcgactactcaggggtggagatgctg
catcaggaggcgcgacggttgttacgccagaatcgcagtttgacgttgcgccgggcgcgg
ccgcaggtggtggaggagttgcgcaagcttgaggggccggagaagtgcccgatccggttt
gaggattga
DBGET
integrated database retrieval system