Pseudomonas tensinigenes: HU718_022355 Help Entry HU718_022355      CDS       T07620                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptz  Pseudomonas tensinigenes Pathway ptz01100   Metabolic pathways ptz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HU718_022355 (acpP)    00074 Mycolic acid biosynthesis     HU718_022355 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HU718_022355 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  QXI04763 UniProt:  A0ABX8PTQ2 LinkDB All DBs Position complement(5058527..5058763) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggtgttaaagaa gaagaagtggtcaacaccgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gagaagatcactactgtacaagctgcaatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system