Panthera uncia (snow leopard): 125908698 Help Entry 125908698         CDS       T08832                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism puc  Panthera uncia (snow leopard) Pathway puc04613   Neutrophil extracellular trap formation puc05034   Alcoholism puc05202   Transcriptional misregulation in cancer puc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:puc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125908698  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125908698   09163 Immune disease    05322 Systemic lupus erythematosus     125908698   09165 Substance dependence    05034 Alcoholism     125908698  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:puc03036]     125908698   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125908698 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125908698 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125908698 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  125908698 NCBI-ProteinID:  XP_049467381 LinkDB All DBs Position B3 Genome browser AA seq 136 aa AA seqDB search MARTKQTASKSTGGKAPRKQLATKAAPKSAPSTGGVKKPHCYRPGTVALREIRRYQKSTA LLFHELPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVSLFEDTSLCAIHAKRVTI MPKDVQLEHRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgccagcaaatccactgggggtaaagcaccgaggaagcaa ctggctacaaaagccgctcccaagagtgcgccctctactggaggggtgaagaaacctcat tgttacaggcctggtaccgtggcactccgcgaaattagacgttaccagaagtccactgca cttctgttccacgaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagcgcggctatcggtgctttgcaggaggcaagcgaggcctac ctggtgagcctcttcgaagacaccagcctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacgtccagctagagcaccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system