Panthera uncia (snow leopard): 125909567 Help Entry 125909567         CDS       T08832                                  Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism puc  Panthera uncia (snow leopard) Pathway puc04024   cAMP signaling pathway puc04062   Chemokine signaling pathway puc04064   NF-kappa B signaling pathway puc04210   Apoptosis puc04380   Osteoclast differentiation puc04620   Toll-like receptor signaling pathway puc04621   NOD-like receptor signaling pathway puc04622   RIG-I-like receptor signaling pathway puc04623   Cytosolic DNA-sensing pathway puc04625   C-type lectin receptor signaling pathway puc04657   IL-17 signaling pathway puc04658   Th1 and Th2 cell differentiation puc04659   Th17 cell differentiation puc04660   T cell receptor signaling pathway puc04662   B cell receptor signaling pathway puc04668   TNF signaling pathway puc04722   Neurotrophin signaling pathway puc04920   Adipocytokine signaling pathway puc04926   Relaxin signaling pathway puc04931   Insulin resistance puc04936   Alcoholic liver disease puc05132   Salmonella infection puc05134   Legionellosis puc05135   Yersinia infection puc05140   Leishmaniasis puc05142   Chagas disease puc05145   Toxoplasmosis puc05160   Hepatitis C puc05161   Hepatitis B puc05162   Measles puc05163   Human cytomegalovirus infection puc05164   Influenza A puc05166   Human T-cell leukemia virus 1 infection puc05167   Kaposi sarcoma-associated herpesvirus infection puc05168   Herpes simplex virus 1 infection puc05169   Epstein-Barr virus infection puc05170   Human immunodeficiency virus 1 infection puc05171   Coronavirus disease - COVID-19 puc05200   Pathways in cancer puc05203   Viral carcinogenesis puc05208   Chemical carcinogenesis - reactive oxygen species puc05215   Prostate cancer puc05220   Chronic myeloid leukemia puc05222   Small cell lung cancer puc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     125909567    04668 TNF signaling pathway     125909567    04024 cAMP signaling pathway     125909567  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     125909567  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125909567    04621 NOD-like receptor signaling pathway     125909567    04622 RIG-I-like receptor signaling pathway     125909567    04623 Cytosolic DNA-sensing pathway     125909567    04625 C-type lectin receptor signaling pathway     125909567    04660 T cell receptor signaling pathway     125909567    04658 Th1 and Th2 cell differentiation     125909567    04659 Th17 cell differentiation     125909567    04657 IL-17 signaling pathway     125909567    04662 B cell receptor signaling pathway     125909567    04062 Chemokine signaling pathway     125909567   09152 Endocrine system    04920 Adipocytokine signaling pathway     125909567    04926 Relaxin signaling pathway     125909567   09156 Nervous system    04722 Neurotrophin signaling pathway     125909567   09158 Development and regeneration    04380 Osteoclast differentiation     125909567  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125909567    05208 Chemical carcinogenesis - reactive oxygen species     125909567    05203 Viral carcinogenesis     125909567    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125909567   09162 Cancer: specific types    05220 Chronic myeloid leukemia     125909567    05215 Prostate cancer     125909567    05222 Small cell lung cancer     125909567   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125909567    05170 Human immunodeficiency virus 1 infection     125909567    05161 Hepatitis B     125909567    05160 Hepatitis C     125909567    05171 Coronavirus disease - COVID-19     125909567    05164 Influenza A     125909567    05162 Measles     125909567    05168 Herpes simplex virus 1 infection     125909567    05163 Human cytomegalovirus infection     125909567    05167 Kaposi sarcoma-associated herpesvirus infection     125909567    05169 Epstein-Barr virus infection     125909567   09171 Infectious disease: bacterial    05132 Salmonella infection     125909567    05135 Yersinia infection     125909567    05134 Legionellosis     125909567   09174 Infectious disease: parasitic    05145 Toxoplasmosis     125909567    05140 Leishmaniasis     125909567    05142 Chagas disease     125909567   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125909567   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125909567    04931 Insulin resistance     125909567  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:puc03000]     125909567    04131 Membrane trafficking [BR:puc04131]     125909567 Transcription factors [BR:puc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     125909567 Membrane trafficking [BR:puc04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     125909567 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 Motif Other DBs NCBI-GeneID:  125909567 NCBI-ProteinID:  XP_049468843 LinkDB All DBs Position B3 Genome browser AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGTEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaacccgccgagcacgcccaggactgggccatggagggtccccgggacgcgctc aaaaaagagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgggagatccggcttgagccccaggaggcgccg cgcggcaccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcattgaccatggaagtagtccgccaagtgaaaggagac ctggccttcctcaatttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctactccatcctgcaggccaccaac tacaatggtcacacatgtctacacttagcctctatccatggctacctgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc ctccatcttgcagtggacctgcagaattccgacctcgtgtcgcttttgttgaagtgcggg gctgatgtcaacagagtcacctaccaaggctactccccgtaccagctcacctggggtcgc ccaagtacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctacgacacggagtcagagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system