Panthera uncia (snow leopard): 125911071 Help Entry 125911071         CDS       T08832                                  Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism puc  Panthera uncia (snow leopard) Pathway puc04022   cGMP-PKG signaling pathway puc04081   Hormone signaling puc04270   Vascular smooth muscle contraction puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     125911071   09133 Signaling molecules and interaction    04081 Hormone signaling     125911071  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     125911071  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125911071  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125911071 Cytokines and neuropeptides [BR:puc04052]  Neuropeptides   Unclassified    125911071 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  125911071 NCBI-ProteinID:  XP_049470645 LinkDB All DBs Position C1 Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tctgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccaggggaggagctg gccgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggtggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcggcgtgggcccgccttctgcacgagcaccctaacgcgcgcaaatacaaggga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccgaatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system