Panthera uncia (snow leopard): 125911864 Help Entry 125911864         CDS       T08832                                  Name (RefSeq) cofilin-2-like   KO K05765   cofilin Organism puc  Panthera uncia (snow leopard) Pathway puc04360   Axon guidance puc04666   Fc gamma R-mediated phagocytosis puc04810   Regulation of actin cytoskeleton puc05133   Pertussis puc05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:puc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125911864  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     125911864   09158 Development and regeneration    04360 Axon guidance     125911864  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125911864   09171 Infectious disease: bacterial    05133 Pertussis     125911864  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:puc04131]     125911864   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:puc04812]     125911864    04147 Exosome [BR:puc04147]     125911864 Membrane trafficking [BR:puc04131]  Others   Actin-binding proteins    Others     125911864 Cytoskeleton proteins [BR:puc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      125911864 Exosome [BR:puc04147]  Exosomal proteins   Proteins found in most exosomes    125911864 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  125911864 NCBI-ProteinID:  XP_049472040 LinkDB All DBs Position C1 Genome browser AA seq 133 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI DDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSNMIYASS KDAVKGRLGGSVG NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggcttctggagttacagtgaatgatgaagtcatcaaagtttttaatgatatgaaagta agaaaatcttctacacaagaggagatcaaaaaaagaaagaaagctgttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt gatgatactgtagaggacccctacacatcttttgtgaagttgctgcctctgaatgattgc cgatatgctttgtacgatgccacctacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgagagtgcacctttaaaaagcaacatgatttatgctagctct aaagatgccgttaaggggcgcctgggtggctcagtcggttga

DBGET integrated database retrieval system