Panthera uncia (snow leopard): 125912078 Help Entry 125912078         CDS       T08832                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism puc  Panthera uncia (snow leopard) Pathway puc04382   Cornified envelope formation puc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:puc00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     125912078  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125912078  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125912078 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of microglial cells    125912078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  125912078 NCBI-ProteinID:  XP_049472200 LinkDB All DBs Position C1 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaacgatgatgttcacgttccacaagtttgct ggggacaaaggctacctaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggctgtggacaagataatgaaggacctagac cagtgccgggacggcagagtgggtttccagagcttcttttcgctgattgctgggctcacc atcgcatgcaatgactattttgtagttcacatgaagcagaaaggaaagaagtag

DBGET integrated database retrieval system