Panthera uncia (snow leopard): 125912218 Help Entry 125912218         CDS       T08832                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism puc  Panthera uncia (snow leopard) Pathway puc01521   EGFR tyrosine kinase inhibitor resistance puc01522   Endocrine resistance puc04010   MAPK signaling pathway puc04012   ErbB signaling pathway puc04014   Ras signaling pathway puc04015   Rap1 signaling pathway puc04062   Chemokine signaling pathway puc04068   FoxO signaling pathway puc04071   Sphingolipid signaling pathway puc04072   Phospholipase D signaling pathway puc04137   Mitophagy - animal puc04140   Autophagy - animal puc04150   mTOR signaling pathway puc04151   PI3K-Akt signaling pathway puc04210   Apoptosis puc04211   Longevity regulating pathway puc04213   Longevity regulating pathway - multiple species puc04218   Cellular senescence puc04360   Axon guidance puc04370   VEGF signaling pathway puc04371   Apelin signaling pathway puc04540   Gap junction puc04550   Signaling pathways regulating pluripotency of stem cells puc04625   C-type lectin receptor signaling pathway puc04650   Natural killer cell mediated cytotoxicity puc04660   T cell receptor signaling pathway puc04662   B cell receptor signaling pathway puc04664   Fc epsilon RI signaling pathway puc04714   Thermogenesis puc04720   Long-term potentiation puc04722   Neurotrophin signaling pathway puc04725   Cholinergic synapse puc04726   Serotonergic synapse puc04730   Long-term depression puc04810   Regulation of actin cytoskeleton puc04910   Insulin signaling pathway puc04912   GnRH signaling pathway puc04915   Estrogen signaling pathway puc04916   Melanogenesis puc04917   Prolactin signaling pathway puc04919   Thyroid hormone signaling pathway puc04921   Oxytocin signaling pathway puc04926   Relaxin signaling pathway puc04929   GnRH secretion puc04933   AGE-RAGE signaling pathway in diabetic complications puc04935   Growth hormone synthesis, secretion and action puc05010   Alzheimer disease puc05022   Pathways of neurodegeneration - multiple diseases puc05034   Alcoholism puc05160   Hepatitis C puc05161   Hepatitis B puc05163   Human cytomegalovirus infection puc05165   Human papillomavirus infection puc05166   Human T-cell leukemia virus 1 infection puc05167   Kaposi sarcoma-associated herpesvirus infection puc05170   Human immunodeficiency virus 1 infection puc05200   Pathways in cancer puc05203   Viral carcinogenesis puc05205   Proteoglycans in cancer puc05206   MicroRNAs in cancer puc05207   Chemical carcinogenesis - receptor activation puc05208   Chemical carcinogenesis - reactive oxygen species puc05210   Colorectal cancer puc05211   Renal cell carcinoma puc05213   Endometrial cancer puc05214   Glioma puc05215   Prostate cancer puc05216   Thyroid cancer puc05218   Melanoma puc05219   Bladder cancer puc05220   Chronic myeloid leukemia puc05221   Acute myeloid leukemia puc05223   Non-small cell lung cancer puc05224   Breast cancer puc05225   Hepatocellular carcinoma puc05226   Gastric cancer puc05230   Central carbon metabolism in cancer puc05231   Choline metabolism in cancer puc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125912218    04012 ErbB signaling pathway     125912218    04014 Ras signaling pathway     125912218    04015 Rap1 signaling pathway     125912218    04370 VEGF signaling pathway     125912218    04371 Apelin signaling pathway     125912218    04068 FoxO signaling pathway     125912218    04072 Phospholipase D signaling pathway     125912218    04071 Sphingolipid signaling pathway     125912218    04151 PI3K-Akt signaling pathway     125912218    04150 mTOR signaling pathway     125912218  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125912218    04137 Mitophagy - animal     125912218   09143 Cell growth and death    04210 Apoptosis     125912218    04218 Cellular senescence     125912218   09144 Cellular community - eukaryotes    04540 Gap junction     125912218    04550 Signaling pathways regulating pluripotency of stem cells     125912218   09142 Cell motility    04810 Regulation of actin cytoskeleton     125912218  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125912218    04650 Natural killer cell mediated cytotoxicity     125912218    04660 T cell receptor signaling pathway     125912218    04662 B cell receptor signaling pathway     125912218    04664 Fc epsilon RI signaling pathway     125912218    04062 Chemokine signaling pathway     125912218   09152 Endocrine system    04910 Insulin signaling pathway     125912218    04929 GnRH secretion     125912218    04912 GnRH signaling pathway     125912218    04915 Estrogen signaling pathway     125912218    04917 Prolactin signaling pathway     125912218    04921 Oxytocin signaling pathway     125912218    04926 Relaxin signaling pathway     125912218    04935 Growth hormone synthesis, secretion and action     125912218    04919 Thyroid hormone signaling pathway     125912218    04916 Melanogenesis     125912218   09156 Nervous system    04725 Cholinergic synapse     125912218    04726 Serotonergic synapse     125912218    04720 Long-term potentiation     125912218    04730 Long-term depression     125912218    04722 Neurotrophin signaling pathway     125912218   09158 Development and regeneration    04360 Axon guidance     125912218   09149 Aging    04211 Longevity regulating pathway     125912218    04213 Longevity regulating pathway - multiple species     125912218   09159 Environmental adaptation    04714 Thermogenesis     125912218  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125912218    05206 MicroRNAs in cancer     125912218    05205 Proteoglycans in cancer     125912218    05207 Chemical carcinogenesis - receptor activation     125912218    05208 Chemical carcinogenesis - reactive oxygen species     125912218    05203 Viral carcinogenesis     125912218    05230 Central carbon metabolism in cancer     125912218    05231 Choline metabolism in cancer     125912218    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125912218   09162 Cancer: specific types    05210 Colorectal cancer     125912218    05225 Hepatocellular carcinoma     125912218    05226 Gastric cancer     125912218    05214 Glioma     125912218    05216 Thyroid cancer     125912218    05221 Acute myeloid leukemia     125912218    05220 Chronic myeloid leukemia     125912218    05218 Melanoma     125912218    05211 Renal cell carcinoma     125912218    05219 Bladder cancer     125912218    05215 Prostate cancer     125912218    05213 Endometrial cancer     125912218    05224 Breast cancer     125912218    05223 Non-small cell lung cancer     125912218   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125912218    05170 Human immunodeficiency virus 1 infection     125912218    05161 Hepatitis B     125912218    05160 Hepatitis C     125912218    05163 Human cytomegalovirus infection     125912218    05167 Kaposi sarcoma-associated herpesvirus infection     125912218    05165 Human papillomavirus infection     125912218   09164 Neurodegenerative disease    05010 Alzheimer disease     125912218    05022 Pathways of neurodegeneration - multiple diseases     125912218   09165 Substance dependence    05034 Alcoholism     125912218   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125912218   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     125912218   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     125912218    01522 Endocrine resistance     125912218  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:puc04131]     125912218   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125912218    04031 GTP-binding proteins [BR:puc04031]     125912218 Membrane trafficking [BR:puc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     125912218  Endocytosis   Macropinocytosis    Ras GTPases     125912218 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125912218   Exosomal proteins of other body fluids (saliva and urine)    125912218   Exosomal proteins of breast cancer cells    125912218   Exosomal proteins of colorectal cancer cells    125912218 GTP-binding proteins [BR:puc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     125912218 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  125912218 NCBI-ProteinID:  XP_049472470 LinkDB All DBs Position C1 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgacgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggaccgtcgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system