Panthera uncia (snow leopard): 125913623 Help Entry 125913623         CDS       T08832                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism puc  Panthera uncia (snow leopard) Pathway puc04621   NOD-like receptor signaling pathway puc05012   Parkinson disease puc05132   Salmonella infection puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125913623  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125913623   09164 Neurodegenerative disease    05012 Parkinson disease     125913623   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125913623  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:puc03110]     125913623 Chaperones and folding catalysts [BR:puc03110]  Protein folding catalysts   Protein disulfide isomerase    125913623 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_9 DIM1 Thioredoxin_7 Redoxin DUF19 OST3_OST6 AhpC-TSA Motif Other DBs NCBI-GeneID:  125913623 NCBI-ProteinID:  XP_049474812 LinkDB All DBs Position C1 Genome browser AA seq 118 aa AA seqDB search MVLTAACQTPTAKMVKQIESKYAFQEALNSAGEKLVVVDFSAMWCGPCKTIKPFFHSFSD KYSNMAFLEADVDDCWDVASEHEVKCMPTFQFFKKGQKVGELSGASKEKLEATINELI NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggtccttacagccgcttgtcagaccccaacagccaaaatggtgaagcagattgagagc aagtatgcttttcaggaagccttgaacagtgcaggggaaaaacttgtagtagttgacttt tcagccatgtggtgtgggccttgcaaaacgattaagcctttctttcattccttctctgac aagtattccaacatggcgttccttgaagcagatgtggatgactgttgggatgttgcttca gagcatgaagtcaaatgcatgccaaccttccagttttttaaaaaaggacaaaaggtgggt gaactttctggggctagtaaggaaaaacttgaagctaccattaatgaattaatctaa

DBGET integrated database retrieval system