Panthera uncia (snow leopard): 125917142 Help Entry 125917142         CDS       T08832                                  Name (RefSeq) C-C motif chemokine 22-like   KO K21095   C-C motif chemokine 22 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04062   Chemokine signaling pathway puc04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125917142    04061 Viral protein interaction with cytokine and cytokine receptor     125917142  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125917142    04062 Chemokine signaling pathway     125917142  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125917142 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Chemokines    125917142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  125917142 NCBI-ProteinID:  XP_049479362 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLKILFLAVLVLLAMTLQATEAGPYGANVEDSVCCRDYFRHPLPSRMLKYFYWTSDSC RRPGVVFLTVRDREICADPRLPWVKKILQKMNP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagattctgttcctggctgtccttgtcctccttgccatgacacttcag gcaactgaggcaggcccctatggcgccaacgtggaagacagcgtctgctgccgagactac ttccgccaccccctgccctctcgtatgctgaagtatttctactggacttcagactcctgc cggaggcccggcgtggtcttccttacggtcagggaccgggagatctgtgctgaccccagg ctgccctgggtgaagaagattctgcagaagatgaacccatga

DBGET integrated database retrieval system