Panthera uncia (snow leopard): 125921200 Help Entry 125921200         CDS       T08832                                  Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04620   Toll-like receptor signaling pathway puc04622   RIG-I-like receptor signaling pathway puc04625   C-type lectin receptor signaling pathway puc04630   JAK-STAT signaling pathway puc04658   Th1 and Th2 cell differentiation puc04936   Alcoholic liver disease puc04940   Type I diabetes mellitus puc05133   Pertussis puc05134   Legionellosis puc05140   Leishmaniasis puc05142   Chagas disease puc05143   African trypanosomiasis puc05144   Malaria puc05145   Toxoplasmosis puc05146   Amoebiasis puc05152   Tuberculosis puc05162   Measles puc05164   Influenza A puc05168   Herpes simplex virus 1 infection puc05171   Coronavirus disease - COVID-19 puc05200   Pathways in cancer puc05321   Inflammatory bowel disease puc05330   Allograft rejection puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125921200   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125921200  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125921200    04622 RIG-I-like receptor signaling pathway     125921200    04625 C-type lectin receptor signaling pathway     125921200    04658 Th1 and Th2 cell differentiation     125921200  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125921200   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     125921200    05164 Influenza A     125921200    05162 Measles     125921200    05168 Herpes simplex virus 1 infection     125921200   09171 Infectious disease: bacterial    05133 Pertussis     125921200    05134 Legionellosis     125921200    05152 Tuberculosis     125921200   09174 Infectious disease: parasitic    05146 Amoebiasis     125921200    05144 Malaria     125921200    05145 Toxoplasmosis     125921200    05140 Leishmaniasis     125921200    05142 Chagas disease     125921200    05143 African trypanosomiasis     125921200   09163 Immune disease    05321 Inflammatory bowel disease     125921200    05330 Allograft rejection     125921200   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125921200   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     125921200    04936 Alcoholic liver disease     125921200  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125921200    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125921200 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Interleukins    125921200 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Cytokines    125921200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 DUF6482 DUF5952 Motif Other DBs NCBI-GeneID:  125921200 NCBI-ProteinID:  XP_049484588 LinkDB All DBs Position C2:complement(102562770..102570315) Genome browser AA seq 222 aa AA seqDB search MCPPRGLLLVTILVLLNHLDHLSLARSLPTPTPSPGMFQCLNHSQTLLRAISNTLQKARQ TLEFYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKTS FMTTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNVNSVTV PQNSSLEEPDFYKTKIKLCILLHAFRIRAVTINRMMNYLNSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgccgcgtggcctcctccttgtaaccatcctggtcctattaaaccacctggac cacctcagtttggccaggagcctccccacacccacaccaagcccaggaatgttccagtgc ctcaaccactcccaaaccctgctgcgagccatcagcaacacgcttcagaaggccagacaa actctagaattttactcctgcacttccgaagagattgatcatgaagatatcacaaaagat aaaaccagcacagtggaggcctgcttaccactggaattaaccatgaatgagagttgcctg gcttccagagagatctctctgataactaatgggagttgcctggcctccagaaagacctct tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag ttcaaggccatgaatgcaaagctgttaatggatcctaaaaggcagatctttctggatcaa aacatgctgacagctattgatgagctgttacaggccctgaatgtcaacagtgtgactgtg ccacagaactcctccctggaagaaccggatttttataaaactaaaatcaagctctgcata cttcttcatgctttcagaattcgtgcagtgaccatcaatagaatgatgaactatctgaat tcttcctaa

DBGET integrated database retrieval system