Panthera uncia (snow leopard): 125922823 Help Entry 125922823         CDS       T08832                                  Name (RefSeq) platelet factor 4-like   KO K05407   platelet factor 4 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125922823    04061 Viral protein interaction with cytokine and cytokine receptor     125922823  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     125922823  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125922823    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125922823 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Chemokines    125922823 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Chemokines    125922823 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  125922823 NCBI-ProteinID:  XP_049486595 LinkDB All DBs Position B1:58414610..58415903 Genome browser AA seq 104 aa AA seqDB search MRLRVGSRAPSPLPSSGLLLLGLLLLPAVVSLPRVDPEDEHLRCVCVKTTSEVRPKYIRS LEVMGATVHCPVPQMIASLKNGRKICLDPNAPLYKKILRKLLES NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaggcttcgagtgggttcccgcgcccccagtcccctgcccagctcggggctcctgctc ctgggactgctgctcttgccagctgtggtctccctccccagagtggacccagaagatgag cacctgcgctgcgtgtgcgtgaagaccacctccgaagtccgtcccaagtatatccgcagc ctggaggtgatgggtgcgacagtccactgccccgttccccagatgatagcttctctgaag aatggtaggaaaatatgcctggacccgaacgcccccctgtataagaaaatactgcggaag cttttggagagctag

DBGET integrated database retrieval system