Panthera uncia (snow leopard): 125923485 Help Entry 125923485         CDS       T08832                                  Name (RefSeq) beta-defensin 1   KO K23125   beta-defensin 1 Organism puc  Panthera uncia (snow leopard) Pathway puc02010   ABC transporters puc05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     125923485  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     125923485  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:puc02000]     125923485    03037 Cilium and associated proteins [BR:puc03037]     125923485 Transporters [BR:puc02000]  Other transporters   Pores ion channels [TC:1]    125923485 Cilium and associated proteins [BR:puc03037]  Motile cilia and associated proteins   Sperm associated proteins    125923485 SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Defb50 Motif Other DBs NCBI-GeneID:  125923485 NCBI-ProteinID:  XP_049487772 LinkDB All DBs Position B1:193884932..193897149 Genome browser AA seq 68 aa AA seqDB search MKALCFLLLALCLLSRLAPGAAFLTGLGQRSDHYICARKGGTCNFSPCPLFTRIDGTCYG GKAKCCMR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaggctctctgcttcctgctgctggcgctgtgcctcctctcccgcctggccccaggt gctgcctttctcacgggtctcggccagcggtctgaccactacatatgtgccaggaaagga ggaacctgtaacttttctccatgcccactttttaccaggatcgatggcacctgctatggt ggaaaggccaagtgctgcatgcgctga

DBGET integrated database retrieval system