KEGG   Panthera uncia (snow leopard): 125925154
Entry
125925154         CDS       T08832                                 
Name
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha isoform X1
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
puc  Panthera uncia (snow leopard)
Pathway
puc04015  Rap1 signaling pathway
puc04020  Calcium signaling pathway
puc04022  cGMP-PKG signaling pathway
puc04062  Chemokine signaling pathway
puc04071  Sphingolipid signaling pathway
puc04081  Hormone signaling
puc04082  Neuroactive ligand signaling
puc04261  Adrenergic signaling in cardiomyocytes
puc04270  Vascular smooth muscle contraction
puc04371  Apelin signaling pathway
puc04540  Gap junction
puc04611  Platelet activation
puc04713  Circadian entrainment
puc04720  Long-term potentiation
puc04723  Retrograde endocannabinoid signaling
puc04724  Glutamatergic synapse
puc04725  Cholinergic synapse
puc04726  Serotonergic synapse
puc04728  Dopaminergic synapse
puc04730  Long-term depression
puc04750  Inflammatory mediator regulation of TRP channels
puc04911  Insulin secretion
puc04912  GnRH signaling pathway
puc04915  Estrogen signaling pathway
puc04916  Melanogenesis
puc04918  Thyroid hormone synthesis
puc04921  Oxytocin signaling pathway
puc04922  Glucagon signaling pathway
puc04924  Renin secretion
puc04925  Aldosterone synthesis and secretion
puc04927  Cortisol synthesis and secretion
puc04928  Parathyroid hormone synthesis, secretion and action
puc04929  GnRH secretion
puc04934  Cushing syndrome
puc04935  Growth hormone synthesis, secretion and action
puc04961  Endocrine and other factor-regulated calcium reabsorption
puc04970  Salivary secretion
puc04971  Gastric acid secretion
puc04972  Pancreatic secretion
puc05010  Alzheimer disease
puc05016  Huntington disease
puc05017  Spinocerebellar ataxia
puc05022  Pathways of neurodegeneration - multiple diseases
puc05135  Yersinia infection
puc05142  Chagas disease
puc05143  African trypanosomiasis
puc05146  Amoebiasis
puc05163  Human cytomegalovirus infection
puc05170  Human immunodeficiency virus 1 infection
puc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:puc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    125925154
   04371 Apelin signaling pathway
    125925154
   04020 Calcium signaling pathway
    125925154
   04071 Sphingolipid signaling pathway
    125925154
   04022 cGMP-PKG signaling pathway
    125925154
  09133 Signaling molecules and interaction
   04082 Neuroactive ligand signaling
    125925154
   04081 Hormone signaling
    125925154
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    125925154
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    125925154
   04062 Chemokine signaling pathway
    125925154
  09152 Endocrine system
   04911 Insulin secretion
    125925154
   04922 Glucagon signaling pathway
    125925154
   04929 GnRH secretion
    125925154
   04912 GnRH signaling pathway
    125925154
   04915 Estrogen signaling pathway
    125925154
   04921 Oxytocin signaling pathway
    125925154
   04935 Growth hormone synthesis, secretion and action
    125925154
   04918 Thyroid hormone synthesis
    125925154
   04928 Parathyroid hormone synthesis, secretion and action
    125925154
   04916 Melanogenesis
    125925154
   04924 Renin secretion
    125925154
   04925 Aldosterone synthesis and secretion
    125925154
   04927 Cortisol synthesis and secretion
    125925154
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    125925154
   04270 Vascular smooth muscle contraction
    125925154
  09154 Digestive system
   04970 Salivary secretion
    125925154
   04971 Gastric acid secretion
    125925154
   04972 Pancreatic secretion
    125925154
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    125925154
  09156 Nervous system
   04724 Glutamatergic synapse
    125925154
   04725 Cholinergic synapse
    125925154
   04728 Dopaminergic synapse
    125925154
   04726 Serotonergic synapse
    125925154
   04720 Long-term potentiation
    125925154
   04730 Long-term depression
    125925154
   04723 Retrograde endocannabinoid signaling
    125925154
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    125925154
  09159 Environmental adaptation
   04713 Circadian entrainment
    125925154
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    125925154
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    125925154
   05163 Human cytomegalovirus infection
    125925154
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    125925154
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    125925154
   05142 Chagas disease
    125925154
   05143 African trypanosomiasis
    125925154
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125925154
   05016 Huntington disease
    125925154
   05017 Spinocerebellar ataxia
    125925154
   05022 Pathways of neurodegeneration - multiple diseases
    125925154
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    125925154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:puc04147]
    125925154
   04031 GTP-binding proteins [BR:puc04031]
    125925154
Exosome [BR:puc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   125925154
GTP-binding proteins [BR:puc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    125925154
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 125925154
NCBI-ProteinID: XP_049489924
LinkDB
Position
D4:complement(18678184..19033134)
AA seq 371 aa
MEIAVNHPEVIFVERQQERIGGSCTLMHIRSISRTCQNTPGPTPPGMGPPERTLPQAGTG
ESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKA
HAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVA
DPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMF
LVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHL
VDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTI
LQLNLKEYNLV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggaaatagcagtaaaccacccagaggtgatttttgttgagagacagcaggaaagaatt
gggggttcttgcactttgatgcacatcagaagcatctcgagaacttgtcaaaatacacct
ggccccacacctccagggatgggcccccctgaacgcacgcttccacaagctgggacagga
gagagcggcaagagtacgtttatcaagcagatgagaatcatccatgggtcaggctactct
gatgaagacaaaaggggcttcaccaagctggtgtatcagaacatcttcacggccatgcag
gctatgatcagagccatggacacgctcaagatcccctacaagtacgagcacaataaggct
catgcacaattagttcgagaagtcgatgtggagaaggtgtctgcttttgagaatccatac
gtagatgcaataaagagtttatggaatgatcctggaatccaggaatgctatgatagacga
cgagaatatcagttgtctgactctaccaaatactatcttaatgacttggaccgtgttgcc
gaccccgcctacctgcctacgcaacaagatgtgcttagagttcgagtccccaccacaggg
atcatcgaatacccctttgacttacaaagtgtcattttcagaatggtcgatgtagggggc
cagaggtcagagagaagaaaatggatacactgctttgaaaatgtcacctctatcatgttt
ctagtagcgcttagtgaatatgatcaagttctcgtggagtcggacaatgagaaccgaatg
gaggaaagcaaagcactctttagaacaattatcacatatccctggttccagaattcctcg
gttattctattcttaaacaagaaagatcttctagaggagaaaattatgtattcccaccta
gttgactacttcccagaatatgatggaccccagagagatgcccaggcagctcgagaattc
atcctgaagatgttcgtggacctgaaccctgacagtgacaaaattatctactcccacttc
acatgcgccacagataccgagaacatccgctttgtctttgccgccgtcaaggacaccatc
ctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system