Panthera uncia (snow leopard): 125925853 Help Entry 125925853         CDS       T08832                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism puc  Panthera uncia (snow leopard) Pathway puc04613   Neutrophil extracellular trap formation puc05034   Alcoholism puc05202   Transcriptional misregulation in cancer puc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:puc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125925853  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     125925853   09163 Immune disease    05322 Systemic lupus erythematosus     125925853   09165 Substance dependence    05034 Alcoholism     125925853  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:puc03036]     125925853   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125925853 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125925853 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125925853 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  125925853 NCBI-ProteinID:  XP_049491061 LinkDB All DBs Position F1:2094111..2101068 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccgggggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtaccgtggcactccgcgaaattagacgttaccagaagtccactgaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagcgcggctatcggtgctttgcaggaggcaagcgaggcctac ctggtgggcctcttcgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcgcgccgcatacgtggagagcgtgcttaa

DBGET integrated database retrieval system