Panthera uncia (snow leopard): 125925935 Help Entry 125925935         CDS       T08832                                  Name (RefSeq) interferon beta-like   KO K05414   interferon alpha Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04151   PI3K-Akt signaling pathway puc04217   Necroptosis puc04620   Toll-like receptor signaling pathway puc04621   NOD-like receptor signaling pathway puc04622   RIG-I-like receptor signaling pathway puc04623   Cytosolic DNA-sensing pathway puc04630   JAK-STAT signaling pathway puc04650   Natural killer cell mediated cytotoxicity puc04936   Alcoholic liver disease puc05152   Tuberculosis puc05160   Hepatitis C puc05161   Hepatitis B puc05162   Measles puc05163   Human cytomegalovirus infection puc05164   Influenza A puc05165   Human papillomavirus infection puc05167   Kaposi sarcoma-associated herpesvirus infection puc05168   Herpes simplex virus 1 infection puc05169   Epstein-Barr virus infection puc05170   Human immunodeficiency virus 1 infection puc05171   Coronavirus disease - COVID-19 puc05200   Pathways in cancer puc05320   Autoimmune thyroid disease puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125925935    04151 PI3K-Akt signaling pathway     125925935   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125925935  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125925935  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125925935    04621 NOD-like receptor signaling pathway     125925935    04622 RIG-I-like receptor signaling pathway     125925935    04623 Cytosolic DNA-sensing pathway     125925935    04650 Natural killer cell mediated cytotoxicity     125925935  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125925935   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125925935    05161 Hepatitis B     125925935    05160 Hepatitis C     125925935    05171 Coronavirus disease - COVID-19     125925935    05164 Influenza A     125925935    05162 Measles     125925935    05168 Herpes simplex virus 1 infection     125925935    05163 Human cytomegalovirus infection     125925935    05167 Kaposi sarcoma-associated herpesvirus infection     125925935    05169 Epstein-Barr virus infection     125925935    05165 Human papillomavirus infection     125925935   09171 Infectious disease: bacterial    05152 Tuberculosis     125925935   09163 Immune disease    05320 Autoimmune thyroid disease     125925935   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125925935   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125925935  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125925935 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Interferons    125925935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon MRB1590_C Motif Other DBs NCBI-GeneID:  125925935 NCBI-ProteinID:  XP_049491202 LinkDB All DBs Position D4:complement(44500928..44501663) Genome browser AA seq 192 aa AA seqDB search MTSRSLPSWALMLLLSSTACSLDCHFQRRGIWEIVQHLENLGGKFPLRCLKDRSNFRFLQ VAKIDQLPEETAFPAIGEMLRQVFNTFSLNVSQSLWNESRLERLLSGLYQQTEKTGVCLE QDSGQEDHSSSQREGTRLAIKNYFQGIRDYLQGQKYSHCAWEVIRVEIRRCFLFIEQLTR RHRDQEIGHLHN NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgaccagccggagcttgccgagctgggctttgatgctacttctttccagtactgcctgc tctctggactgtcactttcaacggaggggcatctgggagattgtacaacatttagagaac cttggaggaaaatttcccctgagatgtctgaaggacagaagcaacttcagattcctccag gtggcaaaaattgaccagcttccggaggaaactgctttcccggccatcggagaaatgctg cgacaggtcttcaacactttcagcctgaatgtctcccaatcgttgtggaatgaaagccgt ttagagagactcctaagtggactgtatcagcaaacggagaagacaggggtatgcctggag caggactctgggcaggaggatcattcatcctcgcaaagggagggtaccagacttgcaata aagaattatttccaaggcatccgtgactatttgcaaggccaaaagtatagccactgtgcc tgggaggtcatccgtgtggaaatccgaaggtgttttctcttcattgaacagctgacaaga agacatcgggaccaagaaataggtcacttacataactaa

DBGET integrated database retrieval system