Panthera uncia (snow leopard): 125926203 Help Entry 125926203         CDS       T08832                                  Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism puc  Panthera uncia (snow leopard) Pathway puc04010   MAPK signaling pathway puc04020   Calcium signaling pathway puc04022   cGMP-PKG signaling pathway puc04114   Oocyte meiosis puc04218   Cellular senescence puc04310   Wnt signaling pathway puc04360   Axon guidance puc04370   VEGF signaling pathway puc04380   Osteoclast differentiation puc04625   C-type lectin receptor signaling pathway puc04650   Natural killer cell mediated cytotoxicity puc04658   Th1 and Th2 cell differentiation puc04659   Th17 cell differentiation puc04660   T cell receptor signaling pathway puc04662   B cell receptor signaling pathway puc04720   Long-term potentiation puc04724   Glutamatergic synapse puc04921   Oxytocin signaling pathway puc04922   Glucagon signaling pathway puc04924   Renin secretion puc05010   Alzheimer disease puc05014   Amyotrophic lateral sclerosis puc05020   Prion disease puc05022   Pathways of neurodegeneration - multiple diseases puc05031   Amphetamine addiction puc05152   Tuberculosis puc05163   Human cytomegalovirus infection puc05166   Human T-cell leukemia virus 1 infection puc05167   Kaposi sarcoma-associated herpesvirus infection puc05170   Human immunodeficiency virus 1 infection puc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125926203    04310 Wnt signaling pathway     125926203    04370 VEGF signaling pathway     125926203    04020 Calcium signaling pathway     125926203    04022 cGMP-PKG signaling pathway     125926203  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     125926203    04218 Cellular senescence     125926203  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125926203    04650 Natural killer cell mediated cytotoxicity     125926203    04660 T cell receptor signaling pathway     125926203    04658 Th1 and Th2 cell differentiation     125926203    04659 Th17 cell differentiation     125926203    04662 B cell receptor signaling pathway     125926203   09152 Endocrine system    04922 Glucagon signaling pathway     125926203    04921 Oxytocin signaling pathway     125926203    04924 Renin secretion     125926203   09156 Nervous system    04724 Glutamatergic synapse     125926203    04720 Long-term potentiation     125926203   09158 Development and regeneration    04360 Axon guidance     125926203    04380 Osteoclast differentiation     125926203  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125926203   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125926203    05170 Human immunodeficiency virus 1 infection     125926203    05163 Human cytomegalovirus infection     125926203    05167 Kaposi sarcoma-associated herpesvirus infection     125926203   09171 Infectious disease: bacterial    05152 Tuberculosis     125926203   09164 Neurodegenerative disease    05010 Alzheimer disease     125926203    05014 Amyotrophic lateral sclerosis     125926203    05020 Prion disease     125926203    05022 Pathways of neurodegeneration - multiple diseases     125926203   09165 Substance dependence    05031 Amphetamine addiction     125926203   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125926203  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:puc01009]     125926203 Protein phosphatases and associated proteins [BR:puc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      125926203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  125926203 NCBI-ProteinID:  XP_049491355 LinkDB All DBs Position D4:complement(61724746..61725948) Genome browser AA seq 170 aa AA seqDB search MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID IFDTNGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagctagttacccgacggagatgtgctcccacttcaaccacgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggactgttcaggctctctgagcgtg gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac atcttcgacaccaacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctatgac atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg gacagggatggcgacgggagaatatccttcgaggaattcagtgcggtggttggaaacctg gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system