Panthera uncia (snow leopard): 125926795 Help Entry 125926795         CDS       T08832                                  Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04062   Chemokine signaling pathway puc04620   Toll-like receptor signaling pathway puc04621   NOD-like receptor signaling pathway puc04623   Cytosolic DNA-sensing pathway puc04668   TNF signaling pathway puc05020   Prion disease puc05142   Chagas disease puc05163   Human cytomegalovirus infection puc05164   Influenza A puc05168   Herpes simplex virus 1 infection puc05323   Rheumatoid arthritis puc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     125926795   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125926795    04061 Viral protein interaction with cytokine and cytokine receptor     125926795  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125926795    04621 NOD-like receptor signaling pathway     125926795    04623 Cytosolic DNA-sensing pathway     125926795    04062 Chemokine signaling pathway     125926795  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     125926795    05168 Herpes simplex virus 1 infection     125926795    05163 Human cytomegalovirus infection     125926795   09174 Infectious disease: parasitic    05142 Chagas disease     125926795   09163 Immune disease    05323 Rheumatoid arthritis     125926795   09164 Neurodegenerative disease    05020 Prion disease     125926795   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125926795  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125926795    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125926795 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Chemokines    125926795 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Chemokines    125926795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  125926795 NCBI-ProteinID:  XP_049492558 LinkDB All DBs Position E1:36474014..36480975 Genome browser AA seq 91 aa AA seqDB search MKVSPAAFAVLLTAAAFCAPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMP AVVFVTRRKRQVCANPQKKWVRDYINSLEMN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccccagctgcctttgcagtcctcctcactgctgccgctttctgcgctcct gcctctgcatccccatatgcctcggacaccaccccctgttgctttgcctacctctcccac ccactgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgcca gcagtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgg gtgcgggactacatcaactctttggagatgaactag

DBGET integrated database retrieval system