Panthera uncia (snow leopard): 125926808 Help Entry 125926808         CDS       T08832                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04062   Chemokine signaling pathway puc04621   NOD-like receptor signaling pathway puc04657   IL-17 signaling pathway puc04668   TNF signaling pathway puc04933   AGE-RAGE signaling pathway in diabetic complications puc05135   Yersinia infection puc05142   Chagas disease puc05144   Malaria puc05163   Human cytomegalovirus infection puc05164   Influenza A puc05168   Herpes simplex virus 1 infection puc05171   Coronavirus disease - COVID-19 puc05323   Rheumatoid arthritis puc05417   Lipid and atherosclerosis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     125926808   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125926808    04061 Viral protein interaction with cytokine and cytokine receptor     125926808  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125926808    04657 IL-17 signaling pathway     125926808    04062 Chemokine signaling pathway     125926808  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     125926808    05164 Influenza A     125926808    05168 Herpes simplex virus 1 infection     125926808    05163 Human cytomegalovirus infection     125926808   09171 Infectious disease: bacterial    05135 Yersinia infection     125926808   09174 Infectious disease: parasitic    05144 Malaria     125926808    05142 Chagas disease     125926808   09163 Immune disease    05323 Rheumatoid arthritis     125926808   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125926808    05418 Fluid shear stress and atherosclerosis     125926808   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     125926808  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125926808    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125926808 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Chemokines    125926808 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Chemokines    125926808 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  125926808 NCBI-ProteinID:  XP_049492597 LinkDB All DBs Position E1:complement(37647037..37648866) Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLTTAAFSLQVLAQPDAINSPVTCCYTLTNKKISIQRLMSYKRVTSSKCP KEAVIFKTILNKEICADPNQKWVKDSMAHLDKKTQTAKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagcgcttctgtgcctgctgctcacaacagctgccttcagcctccag gtgctcgcccagccagatgcaattaattctccagtcacctgctgctatacactcaccaat aagaagatctcgattcagaggctgatgagctataaaagagtcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaaccag aagtgggtcaaggattccatggcacacctggacaagaaaacccaaactgcaaagccttga

DBGET integrated database retrieval system