Panthera uncia (snow leopard): 125927004 Help Entry 125927004         CDS       T08832                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism puc  Panthera uncia (snow leopard) Pathway puc04621   NOD-like receptor signaling pathway puc05012   Parkinson disease puc05132   Salmonella infection puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125927004  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125927004   09164 Neurodegenerative disease    05012 Parkinson disease     125927004   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125927004  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:puc03110]     125927004 Chaperones and folding catalysts [BR:puc03110]  Protein folding catalysts   Protein disulfide isomerase    125927004 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 DIM1 Thioredoxin_8 A6-like_Thioredoxin-like_C OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin PedC-like Motif Other DBs NCBI-GeneID:  125927004 NCBI-ProteinID:  XP_049492942 LinkDB All DBs Position D4:complement(68864870..68880119) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcaggggaa aaacttgtagtagttgatttctctgccacgtggtgtggaccttgcaaaatgatcaagccc ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagctacc atcaatgaattaatctaa

DBGET integrated database retrieval system