Panthera uncia (snow leopard): 125927105 Help Entry 125927105         CDS       T08832                                  Name (RefSeq) profilin-1   KO K05759   profilin Organism puc  Panthera uncia (snow leopard) Pathway puc04015   Rap1 signaling pathway puc04810   Regulation of actin cytoskeleton puc05014   Amyotrophic lateral sclerosis puc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     125927105  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125927105  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125927105   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     125927105  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:puc04131]     125927105   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:puc04812]     125927105    04147 Exosome [BR:puc04147]     125927105 Membrane trafficking [BR:puc04131]  Others   Actin-binding proteins    Others     125927105 Cytoskeleton proteins [BR:puc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      125927105 Exosome [BR:puc04147]  Exosomal proteins   Proteins found in most exosomes    125927105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  125927105 NCBI-ProteinID:  XP_049493133 LinkDB All DBs Position E1:complement(56967761..56970492) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggatgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaacgggctgacacttgggggccagaaatgctctgttatccgggactcgctgctgcag gacggggaatttaccatggatctccgtaccaagagcaccgggggagctcccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcgggatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system