Panthera uncia (snow leopard): 125927658 Help Entry 125927658         CDS       T08832                                  Name (RefSeq) C-C motif chemokine 1   KO K05514   C-C motif chemokine 1 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125927658    04061 Viral protein interaction with cytokine and cytokine receptor     125927658  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     125927658  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125927658 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Chemokines    125927658 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 C4_MG1 Motif Other DBs NCBI-GeneID:  125927658 NCBI-ProteinID:  XP_049494109 LinkDB All DBs Position E1:37584984..37587900 Genome browser AA seq 94 aa AA seqDB search MKLITVALVCLLLAGMWLHEADSRSMHVSSSNCCFTFVEKKISSQRIQCYKNTSSACSRS SLIIKLKGGRETCVLPTAPWVKQSLKSKEPCLLK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagctcatcaccgtggccctggtgtgcctgctgctggctgggatgtggctgcacgag gcggacagcaggagcatgcacgtatcgtcctccaactgttgcttcacgtttgtggagaag aagatttcctcgcagagaatccagtgttacaaaaacaccagctctgcgtgctcccgcagt agtctaataatcaagctgaagggaggcagagagacctgtgtcttgccgacagccccatgg gttaagcaatctttaaagtccaaggaaccgtgcctgctaaagtaa

DBGET integrated database retrieval system