Panthera uncia (snow leopard): 125927659 Help Entry 125927659         CDS       T08832                                  Name (RefSeq) C-C motif chemokine 13-like   KO K16595   C-C motif chemokine 13 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04062   Chemokine signaling pathway puc04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     125927659   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125927659    04061 Viral protein interaction with cytokine and cytokine receptor     125927659  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     125927659  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125927659    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125927659 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Chemokines    125927659 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Chemokines    125927659 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  125927659 NCBI-ProteinID:  XP_049494110 LinkDB All DBs Position E1:complement(37589290..37591094) Genome browser AA seq 98 aa AA seqDB search MRVSAVLLCLLLAAAAFSLQALAQPGAFSALFPCCFTFNNKKIPLPKLTTYRITSSHCPQ RAVIFRTKLAKEICADPKEKWVQEYVKQLSQKSRALKP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagggtctccgcagtgcttctgtgcctgctgctcgcagctgccgccttcagcctccag gcgcttgcccagccaggtgcattcagtgccctgttcccttgctgtttcacgtttaacaat aagaagatccccttgccgaagctgacgacctatcgaatcaccagcagccactgtccccag agagctgtcatcttcaggacgaagctggccaaggagatctgtgctgacccgaaggagaaa tgggtccaggagtatgtgaaacagctcagtcaaaaatctcgtgccctgaagccttga

DBGET integrated database retrieval system