KEGG   Panthera uncia (snow leopard): 125928028
Entry
125928028         CDS       T08832                                 
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
puc  Panthera uncia (snow leopard)
Pathway
puc01521  EGFR tyrosine kinase inhibitor resistance
puc01522  Endocrine resistance
puc01524  Platinum drug resistance
puc04010  MAPK signaling pathway
puc04012  ErbB signaling pathway
puc04014  Ras signaling pathway
puc04015  Rap1 signaling pathway
puc04022  cGMP-PKG signaling pathway
puc04024  cAMP signaling pathway
puc04062  Chemokine signaling pathway
puc04066  HIF-1 signaling pathway
puc04068  FoxO signaling pathway
puc04071  Sphingolipid signaling pathway
puc04072  Phospholipase D signaling pathway
puc04114  Oocyte meiosis
puc04140  Autophagy - animal
puc04148  Efferocytosis
puc04150  mTOR signaling pathway
puc04151  PI3K-Akt signaling pathway
puc04210  Apoptosis
puc04218  Cellular senescence
puc04261  Adrenergic signaling in cardiomyocytes
puc04270  Vascular smooth muscle contraction
puc04350  TGF-beta signaling pathway
puc04360  Axon guidance
puc04370  VEGF signaling pathway
puc04371  Apelin signaling pathway
puc04380  Osteoclast differentiation
puc04510  Focal adhesion
puc04520  Adherens junction
puc04540  Gap junction
puc04550  Signaling pathways regulating pluripotency of stem cells
puc04611  Platelet activation
puc04613  Neutrophil extracellular trap formation
puc04620  Toll-like receptor signaling pathway
puc04621  NOD-like receptor signaling pathway
puc04625  C-type lectin receptor signaling pathway
puc04650  Natural killer cell mediated cytotoxicity
puc04657  IL-17 signaling pathway
puc04658  Th1 and Th2 cell differentiation
puc04659  Th17 cell differentiation
puc04660  T cell receptor signaling pathway
puc04662  B cell receptor signaling pathway
puc04664  Fc epsilon RI signaling pathway
puc04666  Fc gamma R-mediated phagocytosis
puc04668  TNF signaling pathway
puc04713  Circadian entrainment
puc04720  Long-term potentiation
puc04722  Neurotrophin signaling pathway
puc04723  Retrograde endocannabinoid signaling
puc04724  Glutamatergic synapse
puc04725  Cholinergic synapse
puc04726  Serotonergic synapse
puc04730  Long-term depression
puc04810  Regulation of actin cytoskeleton
puc04910  Insulin signaling pathway
puc04912  GnRH signaling pathway
puc04914  Progesterone-mediated oocyte maturation
puc04915  Estrogen signaling pathway
puc04916  Melanogenesis
puc04917  Prolactin signaling pathway
puc04919  Thyroid hormone signaling pathway
puc04921  Oxytocin signaling pathway
puc04926  Relaxin signaling pathway
puc04928  Parathyroid hormone synthesis, secretion and action
puc04929  GnRH secretion
puc04930  Type II diabetes mellitus
puc04933  AGE-RAGE signaling pathway in diabetic complications
puc04934  Cushing syndrome
puc04935  Growth hormone synthesis, secretion and action
puc04960  Aldosterone-regulated sodium reabsorption
puc05010  Alzheimer disease
puc05020  Prion disease
puc05022  Pathways of neurodegeneration - multiple diseases
puc05034  Alcoholism
puc05132  Salmonella infection
puc05133  Pertussis
puc05135  Yersinia infection
puc05140  Leishmaniasis
puc05142  Chagas disease
puc05145  Toxoplasmosis
puc05152  Tuberculosis
puc05160  Hepatitis C
puc05161  Hepatitis B
puc05163  Human cytomegalovirus infection
puc05164  Influenza A
puc05165  Human papillomavirus infection
puc05166  Human T-cell leukemia virus 1 infection
puc05167  Kaposi sarcoma-associated herpesvirus infection
puc05170  Human immunodeficiency virus 1 infection
puc05171  Coronavirus disease - COVID-19
puc05200  Pathways in cancer
puc05203  Viral carcinogenesis
puc05205  Proteoglycans in cancer
puc05206  MicroRNAs in cancer
puc05207  Chemical carcinogenesis - receptor activation
puc05208  Chemical carcinogenesis - reactive oxygen species
puc05210  Colorectal cancer
puc05211  Renal cell carcinoma
puc05212  Pancreatic cancer
puc05213  Endometrial cancer
puc05214  Glioma
puc05215  Prostate cancer
puc05216  Thyroid cancer
puc05218  Melanoma
puc05219  Bladder cancer
puc05220  Chronic myeloid leukemia
puc05221  Acute myeloid leukemia
puc05223  Non-small cell lung cancer
puc05224  Breast cancer
puc05225  Hepatocellular carcinoma
puc05226  Gastric cancer
puc05230  Central carbon metabolism in cancer
puc05231  Choline metabolism in cancer
puc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
puc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:puc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    125928028
   04012 ErbB signaling pathway
    125928028
   04014 Ras signaling pathway
    125928028
   04015 Rap1 signaling pathway
    125928028
   04350 TGF-beta signaling pathway
    125928028
   04370 VEGF signaling pathway
    125928028
   04371 Apelin signaling pathway
    125928028
   04668 TNF signaling pathway
    125928028
   04066 HIF-1 signaling pathway
    125928028
   04068 FoxO signaling pathway
    125928028
   04072 Phospholipase D signaling pathway
    125928028
   04071 Sphingolipid signaling pathway
    125928028
   04024 cAMP signaling pathway
    125928028
   04022 cGMP-PKG signaling pathway
    125928028
   04151 PI3K-Akt signaling pathway
    125928028
   04150 mTOR signaling pathway
    125928028
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    125928028
   04148 Efferocytosis
    125928028
  09143 Cell growth and death
   04114 Oocyte meiosis
    125928028
   04210 Apoptosis
    125928028
   04218 Cellular senescence
    125928028
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    125928028
   04520 Adherens junction
    125928028
   04540 Gap junction
    125928028
   04550 Signaling pathways regulating pluripotency of stem cells
    125928028
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    125928028
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    125928028
   04613 Neutrophil extracellular trap formation
    125928028
   04620 Toll-like receptor signaling pathway
    125928028
   04621 NOD-like receptor signaling pathway
    125928028
   04625 C-type lectin receptor signaling pathway
    125928028
   04650 Natural killer cell mediated cytotoxicity
    125928028
   04660 T cell receptor signaling pathway
    125928028
   04658 Th1 and Th2 cell differentiation
    125928028
   04659 Th17 cell differentiation
    125928028
   04657 IL-17 signaling pathway
    125928028
   04662 B cell receptor signaling pathway
    125928028
   04664 Fc epsilon RI signaling pathway
    125928028
   04666 Fc gamma R-mediated phagocytosis
    125928028
   04062 Chemokine signaling pathway
    125928028
  09152 Endocrine system
   04910 Insulin signaling pathway
    125928028
   04929 GnRH secretion
    125928028
   04912 GnRH signaling pathway
    125928028
   04915 Estrogen signaling pathway
    125928028
   04914 Progesterone-mediated oocyte maturation
    125928028
   04917 Prolactin signaling pathway
    125928028
   04921 Oxytocin signaling pathway
    125928028
   04926 Relaxin signaling pathway
    125928028
   04935 Growth hormone synthesis, secretion and action
    125928028
   04919 Thyroid hormone signaling pathway
    125928028
   04928 Parathyroid hormone synthesis, secretion and action
    125928028
   04916 Melanogenesis
    125928028
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    125928028
   04270 Vascular smooth muscle contraction
    125928028
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    125928028
  09156 Nervous system
   04724 Glutamatergic synapse
    125928028
   04725 Cholinergic synapse
    125928028
   04726 Serotonergic synapse
    125928028
   04720 Long-term potentiation
    125928028
   04730 Long-term depression
    125928028
   04723 Retrograde endocannabinoid signaling
    125928028
   04722 Neurotrophin signaling pathway
    125928028
  09158 Development and regeneration
   04360 Axon guidance
    125928028
   04380 Osteoclast differentiation
    125928028
  09159 Environmental adaptation
   04713 Circadian entrainment
    125928028
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    125928028
   05206 MicroRNAs in cancer
    125928028
   05205 Proteoglycans in cancer
    125928028
   05207 Chemical carcinogenesis - receptor activation
    125928028
   05208 Chemical carcinogenesis - reactive oxygen species
    125928028
   05203 Viral carcinogenesis
    125928028
   05230 Central carbon metabolism in cancer
    125928028
   05231 Choline metabolism in cancer
    125928028
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    125928028
  09162 Cancer: specific types
   05210 Colorectal cancer
    125928028
   05212 Pancreatic cancer
    125928028
   05225 Hepatocellular carcinoma
    125928028
   05226 Gastric cancer
    125928028
   05214 Glioma
    125928028
   05216 Thyroid cancer
    125928028
   05221 Acute myeloid leukemia
    125928028
   05220 Chronic myeloid leukemia
    125928028
   05218 Melanoma
    125928028
   05211 Renal cell carcinoma
    125928028
   05219 Bladder cancer
    125928028
   05215 Prostate cancer
    125928028
   05213 Endometrial cancer
    125928028
   05224 Breast cancer
    125928028
   05223 Non-small cell lung cancer
    125928028
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    125928028
   05170 Human immunodeficiency virus 1 infection
    125928028
   05161 Hepatitis B
    125928028
   05160 Hepatitis C
    125928028
   05171 Coronavirus disease - COVID-19
    125928028
   05164 Influenza A
    125928028
   05163 Human cytomegalovirus infection
    125928028
   05167 Kaposi sarcoma-associated herpesvirus infection
    125928028
   05165 Human papillomavirus infection
    125928028
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    125928028
   05135 Yersinia infection
    125928028
   05133 Pertussis
    125928028
   05152 Tuberculosis
    125928028
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    125928028
   05140 Leishmaniasis
    125928028
   05142 Chagas disease
    125928028
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125928028
   05020 Prion disease
    125928028
   05022 Pathways of neurodegeneration - multiple diseases
    125928028
  09165 Substance dependence
   05034 Alcoholism
    125928028
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    125928028
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    125928028
   04933 AGE-RAGE signaling pathway in diabetic complications
    125928028
   04934 Cushing syndrome
    125928028
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    125928028
   01524 Platinum drug resistance
    125928028
   01522 Endocrine resistance
    125928028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:puc01001]
    125928028
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:puc03036]
    125928028
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:puc04147]
    125928028
Enzymes [BR:puc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     125928028
Protein kinases [BR:puc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   125928028
Chromosome and associated proteins [BR:puc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     125928028
Exosome [BR:puc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   125928028
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 125928028
NCBI-ProteinID: XP_049494507
LinkDB
Position
E3:16937135..16943346
AA seq 410 aa
MAAAAAQGGGGGEPGGADGVGPGVSGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
AKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEVGQPPATGLVGRWMGKRPSVP
GLSLTSLLPQPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGALEAP
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagcccgggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagcttat
gaccacgtgcgcaagactcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacgctgcgggagatccagatcctgctgcgcttccgccatgagaacgtc
attggcatccgggacattctgcgggcgcccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccacatttgctacttcctctaccagatcctgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgtgattttggcctggcccggattgccgatcctgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaattccaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aacaggcccatcttccctggcaagcactacctggaccagctcaaccacattctggggatc
ctgggctccccatcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcagat
gccaaagccctggatctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaggaagcactggctcacccctacctggagcagtactacgacccaacggatgaggtg
ggccagccaccagcaacagggctggtgggtagatggatgggtaagcgaccctcagtgcct
ggcctgagcctgacttctttactaccccagccagtggccgaggagcctttcaccttcgac
atggagctggatgatctacccaaggagcggctgaaggagctcatcttccaggagacagcc
cgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system