Panthera uncia (snow leopard): 125928074 Help Entry 125928074         CDS       T08832                                  Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism puc  Panthera uncia (snow leopard) Pathway puc04510   Focal adhesion puc04520   Adherens junction puc04670   Leukocyte transendothelial migration puc04810   Regulation of actin cytoskeleton puc04814   Motor proteins puc04820   Cytoskeleton in muscle cells puc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:puc00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     125928074    04520 Adherens junction     125928074   09142 Cell motility    04814 Motor proteins     125928074    04820 Cytoskeleton in muscle cells     125928074    04810 Regulation of actin cytoskeleton     125928074  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     125928074  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125928074  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:puc04812]     125928074    04147 Exosome [BR:puc04147]     125928074 Cytoskeleton proteins [BR:puc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      125928074 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of hepatic cells    125928074 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 MecA_N AIF-1 Motif Other DBs NCBI-GeneID:  125928074 NCBI-ProteinID:  XP_049494588 LinkDB All DBs Position E3:17361255..17363565 Genome browser AA seq 170 aa AA seqDB search MAPKKARRRAAAEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGR LNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDHEGKGTIKKKF LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaggccaggagaagggcggcagcagagggcggaagctccagtgtcttc tccatgttcgaccagactcagatccaagagttcaaggaggccttcacggtaatcgaccag aaccgtgatggcattatcgacaaggaagatctgcgggacaccttcgcagccatggggcgc ctcaatgtgaagaatgaggagctagatgccatgatgaaggaagccagtggtcccatcaac ttcaccgtcttcctgaccatgtttggagagaagcttaaaggtgctgatcctgaggacgtg atcactggagccttcaaggtcctggatcatgaggggaagggcaccatcaagaagaagttc ctggaggagctgcttaccacgcagtgcgaccgcttctcccaggaagagatcaagaacatg tgggcagcgttcccccccgacgtgggaggcaacgtagactacaagaacatctgctacgtc atcacgcatggcgacgccaaggaccaggagtag

DBGET integrated database retrieval system