KEGG   Panthera uncia (snow leopard): 125928294
Entry
125928294         CDS       T08832                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
puc  Panthera uncia (snow leopard)
Pathway
puc04010  MAPK signaling pathway
puc04014  Ras signaling pathway
puc04015  Rap1 signaling pathway
puc04024  cAMP signaling pathway
puc04062  Chemokine signaling pathway
puc04071  Sphingolipid signaling pathway
puc04145  Phagosome
puc04148  Efferocytosis
puc04151  PI3K-Akt signaling pathway
puc04310  Wnt signaling pathway
puc04360  Axon guidance
puc04370  VEGF signaling pathway
puc04380  Osteoclast differentiation
puc04510  Focal adhesion
puc04517  IgSF CAM signaling
puc04518  Integrin signaling
puc04520  Adherens junction
puc04530  Tight junction
puc04613  Neutrophil extracellular trap formation
puc04620  Toll-like receptor signaling pathway
puc04650  Natural killer cell mediated cytotoxicity
puc04662  B cell receptor signaling pathway
puc04664  Fc epsilon RI signaling pathway
puc04666  Fc gamma R-mediated phagocytosis
puc04670  Leukocyte transendothelial migration
puc04722  Neurotrophin signaling pathway
puc04810  Regulation of actin cytoskeleton
puc04932  Non-alcoholic fatty liver disease
puc04933  AGE-RAGE signaling pathway in diabetic complications
puc04972  Pancreatic secretion
puc05014  Amyotrophic lateral sclerosis
puc05020  Prion disease
puc05022  Pathways of neurodegeneration - multiple diseases
puc05100  Bacterial invasion of epithelial cells
puc05132  Salmonella infection
puc05135  Yersinia infection
puc05163  Human cytomegalovirus infection
puc05167  Kaposi sarcoma-associated herpesvirus infection
puc05169  Epstein-Barr virus infection
puc05170  Human immunodeficiency virus 1 infection
puc05200  Pathways in cancer
puc05203  Viral carcinogenesis
puc05205  Proteoglycans in cancer
puc05208  Chemical carcinogenesis - reactive oxygen species
puc05210  Colorectal cancer
puc05211  Renal cell carcinoma
puc05212  Pancreatic cancer
puc05231  Choline metabolism in cancer
puc05415  Diabetic cardiomyopathy
puc05416  Viral myocarditis
puc05417  Lipid and atherosclerosis
puc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:puc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    125928294
   04014 Ras signaling pathway
    125928294
   04015 Rap1 signaling pathway
    125928294
   04310 Wnt signaling pathway
    125928294
   04370 VEGF signaling pathway
    125928294
   04071 Sphingolipid signaling pathway
    125928294
   04024 cAMP signaling pathway
    125928294
   04151 PI3K-Akt signaling pathway
    125928294
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    125928294
   04518 Integrin signaling
    125928294
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    125928294
   04148 Efferocytosis
    125928294
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    125928294
   04520 Adherens junction
    125928294
   04530 Tight junction
    125928294
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    125928294
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    125928294
   04620 Toll-like receptor signaling pathway
    125928294
   04650 Natural killer cell mediated cytotoxicity
    125928294
   04662 B cell receptor signaling pathway
    125928294
   04664 Fc epsilon RI signaling pathway
    125928294
   04666 Fc gamma R-mediated phagocytosis
    125928294
   04670 Leukocyte transendothelial migration
    125928294
   04062 Chemokine signaling pathway
    125928294
  09154 Digestive system
   04972 Pancreatic secretion
    125928294
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    125928294
  09158 Development and regeneration
   04360 Axon guidance
    125928294
   04380 Osteoclast differentiation
    125928294
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    125928294
   05205 Proteoglycans in cancer
    125928294
   05208 Chemical carcinogenesis - reactive oxygen species
    125928294
   05203 Viral carcinogenesis
    125928294
   05231 Choline metabolism in cancer
    125928294
  09162 Cancer: specific types
   05210 Colorectal cancer
    125928294
   05212 Pancreatic cancer
    125928294
   05211 Renal cell carcinoma
    125928294
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    125928294
   05163 Human cytomegalovirus infection
    125928294
   05167 Kaposi sarcoma-associated herpesvirus infection
    125928294
   05169 Epstein-Barr virus infection
    125928294
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    125928294
   05135 Yersinia infection
    125928294
   05100 Bacterial invasion of epithelial cells
    125928294
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    125928294
   05020 Prion disease
    125928294
   05022 Pathways of neurodegeneration - multiple diseases
    125928294
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    125928294
   05418 Fluid shear stress and atherosclerosis
    125928294
   05415 Diabetic cardiomyopathy
    125928294
   05416 Viral myocarditis
    125928294
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    125928294
   04933 AGE-RAGE signaling pathway in diabetic complications
    125928294
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:puc04131]
    125928294
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:puc04147]
    125928294
   04031 GTP-binding proteins [BR:puc04031]
    125928294
Membrane trafficking [BR:puc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    125928294
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    125928294
  Macropinocytosis
   Ras GTPases
    125928294
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    125928294
Exosome [BR:puc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   125928294
  Exosomal proteins of other body fluids (saliva and urine)
   125928294
  Exosomal proteins of colorectal cancer cells
   125928294
  Exosomal proteins of bladder cancer cells
   125928294
GTP-binding proteins [BR:puc04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    125928294
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 125928294
NCBI-ProteinID: XP_049494894
LinkDB
Position
E3:29552032..29575204
AA seq 211 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagccgtaggtaaaacgtgcctactg
atcagttacacaaccaatgcgtttcctggagaatatatccccactgtctttgacaactac
tctgccaatgttatggtggatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgtcccttatcctatccgcaaacagttggagaaacgtat
ggtaaggatataacctccaggggcaaagacaagccgattgccgatgtattcttaatttgc
ttttctcttgtgagtcctgcgtcatttgaaaatgttcgagcaaagtggtaccctgaagtg
cgacaccactgtcccaacacccccatcatcttagtgggaactaaacttgacctcagggac
gacaaagacacgattgagaaactgaaggagaaaaagctgactcccatcacctacccgcag
ggtttggccatggcaaaggagatcggtgctgtaaaatacctggagtgctcggcgctcacg
cagcgaggcctcaagacagtgtttgatgaagctattcgagcggttctctgcccccctccc
gtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system