Panthera uncia (snow leopard): 125929348 Help Entry 125929348         CDS       T08832                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism puc  Panthera uncia (snow leopard) Pathway puc04014   Ras signaling pathway puc04015   Rap1 signaling pathway puc04022   cGMP-PKG signaling pathway puc04024   cAMP signaling pathway puc04062   Chemokine signaling pathway puc04071   Sphingolipid signaling pathway puc04072   Phospholipase D signaling pathway puc04081   Hormone signaling puc04144   Endocytosis puc04150   mTOR signaling pathway puc04270   Vascular smooth muscle contraction puc04310   Wnt signaling pathway puc04350   TGF-beta signaling pathway puc04360   Axon guidance puc04510   Focal adhesion puc04520   Adherens junction puc04530   Tight junction puc04611   Platelet activation puc04621   NOD-like receptor signaling pathway puc04625   C-type lectin receptor signaling pathway puc04660   T cell receptor signaling pathway puc04670   Leukocyte transendothelial migration puc04722   Neurotrophin signaling pathway puc04810   Regulation of actin cytoskeleton puc04921   Oxytocin signaling pathway puc04928   Parathyroid hormone synthesis, secretion and action puc04972   Pancreatic secretion puc05100   Bacterial invasion of epithelial cells puc05132   Salmonella infection puc05133   Pertussis puc05135   Yersinia infection puc05152   Tuberculosis puc05163   Human cytomegalovirus infection puc05200   Pathways in cancer puc05203   Viral carcinogenesis puc05205   Proteoglycans in cancer puc05206   MicroRNAs in cancer puc05210   Colorectal cancer puc05417   Lipid and atherosclerosis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     125929348    04015 Rap1 signaling pathway     125929348    04310 Wnt signaling pathway     125929348    04350 TGF-beta signaling pathway     125929348    04072 Phospholipase D signaling pathway     125929348    04071 Sphingolipid signaling pathway     125929348    04024 cAMP signaling pathway     125929348    04022 cGMP-PKG signaling pathway     125929348    04150 mTOR signaling pathway     125929348   09133 Signaling molecules and interaction    04081 Hormone signaling     125929348  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125929348   09144 Cellular community - eukaryotes    04510 Focal adhesion     125929348    04520 Adherens junction     125929348    04530 Tight junction     125929348   09142 Cell motility    04810 Regulation of actin cytoskeleton     125929348  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     125929348    04621 NOD-like receptor signaling pathway     125929348    04625 C-type lectin receptor signaling pathway     125929348    04660 T cell receptor signaling pathway     125929348    04670 Leukocyte transendothelial migration     125929348    04062 Chemokine signaling pathway     125929348   09152 Endocrine system    04921 Oxytocin signaling pathway     125929348    04928 Parathyroid hormone synthesis, secretion and action     125929348   09153 Circulatory system    04270 Vascular smooth muscle contraction     125929348   09154 Digestive system    04972 Pancreatic secretion     125929348   09156 Nervous system    04722 Neurotrophin signaling pathway     125929348   09158 Development and regeneration    04360 Axon guidance     125929348  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125929348    05206 MicroRNAs in cancer     125929348    05205 Proteoglycans in cancer     125929348    05203 Viral carcinogenesis     125929348   09162 Cancer: specific types    05210 Colorectal cancer     125929348   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     125929348   09171 Infectious disease: bacterial    05132 Salmonella infection     125929348    05135 Yersinia infection     125929348    05133 Pertussis     125929348    05152 Tuberculosis     125929348    05100 Bacterial invasion of epithelial cells     125929348   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125929348    05418 Fluid shear stress and atherosclerosis     125929348  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:puc04131]     125929348   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125929348    04031 GTP-binding proteins [BR:puc04031]     125929348 Membrane trafficking [BR:puc04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     125929348 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125929348   Exosomal proteins of other body fluids (saliva and urine)    125929348   Exosomal proteins of colorectal cancer cells    125929348   Exosomal proteins of bladder cancer cells    125929348 GTP-binding proteins [BR:puc04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     125929348 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  125929348 NCBI-ProteinID:  XP_049496418 LinkDB All DBs Position A2:complement(17426818..17488902) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacaccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccagtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system