Panthera uncia (snow leopard): 125929627 Help Entry 125929627         CDS       T08832                                  Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism puc  Panthera uncia (snow leopard) Pathway puc04810   Regulation of actin cytoskeleton puc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:puc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125929627  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125929627 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  125929627 NCBI-ProteinID:  XP_049496952 LinkDB All DBs Position A2:49559337..49568006 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaactcgttcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagccctcgaacggaga atagagtacattgaagcacgggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system