Panthera uncia (snow leopard): 125929746 Help Entry 125929746         CDS       T08832                                  Name (RefSeq) histone H2A.V isoform X1   KO K11251   histone H2A Organism puc  Panthera uncia (snow leopard) Pathway puc03082   ATP-dependent chromatin remodeling puc04217   Necroptosis puc04613   Neutrophil extracellular trap formation puc05034   Alcoholism puc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:puc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125929746  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125929746  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125929746  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     125929746   09165 Substance dependence    05034 Alcoholism     125929746  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:puc03036]     125929746   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125929746 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125929746 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125929746 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  125929746 NCBI-ProteinID:  XP_049497141 LinkDB All DBs Position A2:complement(58529121..58538987) Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTA NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggagggaaagccggaaaggacagcgggaaggccaaggctaaggcagtgtctcgc tcgcagagagctgggctccagtttcccgtgggccgcatccacagacacttgaagacccgc accacgagccacgggagggtcggcgccacagccgcggtgtacagcgccgcgatcctggag tacctcacggccgaggtgctggagctggcgggtaacgcctccaaggacctcaaggtaaag cggatcaccccgcgccacctgcagctcgcaatccgcggcgatgaagagttggactccctc atcaaggcaaccatcgccgggggtggtgtgatcccgcacatccacaagtctctgatcgga aagaagggacagcagaaaaccgcgtag

DBGET integrated database retrieval system