Panthera uncia (snow leopard): 125930322 Help Entry 125930322         CDS       T08832                                  Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism puc  Panthera uncia (snow leopard) Pathway puc04072   Phospholipase D signaling pathway puc04140   Autophagy - animal puc04150   mTOR signaling pathway puc04151   PI3K-Akt signaling pathway puc04152   AMPK signaling pathway puc04211   Longevity regulating pathway puc04218   Cellular senescence puc04714   Thermogenesis puc04910   Insulin signaling pathway puc04919   Thyroid hormone signaling pathway puc05163   Human cytomegalovirus infection puc05165   Human papillomavirus infection puc05168   Herpes simplex virus 1 infection puc05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     125930322    04151 PI3K-Akt signaling pathway     125930322    04152 AMPK signaling pathway     125930322    04150 mTOR signaling pathway     125930322  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125930322   09143 Cell growth and death    04218 Cellular senescence     125930322  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     125930322    04919 Thyroid hormone signaling pathway     125930322   09149 Aging    04211 Longevity regulating pathway     125930322   09159 Environmental adaptation    04714 Thermogenesis     125930322  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     125930322   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     125930322    05163 Human cytomegalovirus infection     125930322    05165 Human papillomavirus infection     125930322  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:puc04031]     125930322 GTP-binding proteins [BR:puc04031]  Small (monomeric) G-proteins   Ras Family    Rheb     125930322 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  125930322 NCBI-ProteinID:  XP_049498102 LinkDB All DBs Position A2:complement(157351642..157395942) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgactcctacgacccaaccatagaa aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcagcttgttgac acagctggacaagatgaatactccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttattcac ggcaaattgttggatatggtggggaaagtgcaaatacctattatgctggtcgggaataag aaagatctacacatggaaagggtgatcagttatgaagaagggaaagcattagcagagtct tggaacgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgacgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcgtcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system