Panthera uncia (snow leopard): 125930454 Help Entry 125930454         CDS       T08832                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism puc  Panthera uncia (snow leopard) Pathway puc00480   Glutathione metabolism puc00980   Metabolism of xenobiotics by cytochrome P450 puc00982   Drug metabolism - cytochrome P450 puc00983   Drug metabolism - other enzymes puc01100   Metabolic pathways puc01524   Platinum drug resistance puc05200   Pathways in cancer puc05204   Chemical carcinogenesis - DNA adducts puc05215   Prostate cancer puc05225   Hepatocellular carcinoma puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     125930454   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     125930454    00982 Drug metabolism - cytochrome P450     125930454    00983 Drug metabolism - other enzymes     125930454  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125930454    05204 Chemical carcinogenesis - DNA adducts     125930454   09162 Cancer: specific types    05225 Hepatocellular carcinoma     125930454    05215 Prostate cancer     125930454   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125930454   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     125930454  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:puc02000]     125930454 Enzymes [BR:puc01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      125930454 Transporters [BR:puc02000]  Other transporters   Pores ion channels [TC:1]    125930454 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  125930454 NCBI-ProteinID:  XP_049498249 LinkDB All DBs Position D1:complement(4138668..4141386) Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTKETWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRTLGLYGKDQREAALVDVVNDGVEDLRCKYATLIYTNYEAGKKEYV KALPEHLKPFETLLSQNQGGQAFIVGDQISFADYNLLDLLLIHQVLAPGCLDSLPLLSAY VARLSARPKLKAFLASPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccattgtctacttcccggtccgagggcgctgcgaggccatgcgcatg ctgctggccgaccagggccagagctggaaggaagaggtggtgaccaaggagacctggctg cagggcccgctcaaggcctcctgtctgtacgggcagctccccaagttccaggatggagac ctcactctgtaccagtccaatgctatcctgcgacacctggggcgcacgcttgggctatac gggaaggaccagcgcgaggcagctctggtggacgtggtaaatgacggggtggaggacctt cgctgcaaatacgccacccttatctacaccaactatgaggcaggcaagaaggaatatgtg aaggcactgccggagcacctgaagcctttcgagacgctgctgtcccagaaccaggggggc caggccttcatcgtgggcgaccagatctccttcgcggactacaacctgctggacctgctg ctgattcaccaggtcctggcccccggctgcctggactccctccccctgctctcggcctat gtggcgcgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagcacgtg aaccgtcccatcaacggcaacgggaagcagtga

DBGET integrated database retrieval system