Panthera uncia (snow leopard): 125931555 Help Entry 125931555         CDS       T08832                                  Name (RefSeq) calmodulin-alpha-like   KO K02183   calmodulin Organism puc  Panthera uncia (snow leopard) Pathway puc04014   Ras signaling pathway puc04015   Rap1 signaling pathway puc04020   Calcium signaling pathway puc04022   cGMP-PKG signaling pathway puc04024   cAMP signaling pathway puc04070   Phosphatidylinositol signaling system puc04114   Oocyte meiosis puc04218   Cellular senescence puc04261   Adrenergic signaling in cardiomyocytes puc04270   Vascular smooth muscle contraction puc04371   Apelin signaling pathway puc04625   C-type lectin receptor signaling pathway puc04713   Circadian entrainment puc04720   Long-term potentiation puc04722   Neurotrophin signaling pathway puc04728   Dopaminergic synapse puc04740   Olfactory transduction puc04744   Phototransduction puc04750   Inflammatory mediator regulation of TRP channels puc04910   Insulin signaling pathway puc04912   GnRH signaling pathway puc04915   Estrogen signaling pathway puc04916   Melanogenesis puc04921   Oxytocin signaling pathway puc04922   Glucagon signaling pathway puc04924   Renin secretion puc04925   Aldosterone synthesis and secretion puc04970   Salivary secretion puc04971   Gastric acid secretion puc05010   Alzheimer disease puc05012   Parkinson disease puc05022   Pathways of neurodegeneration - multiple diseases puc05031   Amphetamine addiction puc05034   Alcoholism puc05133   Pertussis puc05152   Tuberculosis puc05163   Human cytomegalovirus infection puc05167   Kaposi sarcoma-associated herpesvirus infection puc05170   Human immunodeficiency virus 1 infection puc05200   Pathways in cancer puc05214   Glioma puc05417   Lipid and atherosclerosis puc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     125931555    04015 Rap1 signaling pathway     125931555    04371 Apelin signaling pathway     125931555    04020 Calcium signaling pathway     125931555    04070 Phosphatidylinositol signaling system     125931555    04024 cAMP signaling pathway     125931555    04022 cGMP-PKG signaling pathway     125931555  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     125931555    04218 Cellular senescence     125931555  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125931555   09152 Endocrine system    04910 Insulin signaling pathway     125931555    04922 Glucagon signaling pathway     125931555    04912 GnRH signaling pathway     125931555    04915 Estrogen signaling pathway     125931555    04921 Oxytocin signaling pathway     125931555    04916 Melanogenesis     125931555    04924 Renin secretion     125931555    04925 Aldosterone synthesis and secretion     125931555   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     125931555    04270 Vascular smooth muscle contraction     125931555   09154 Digestive system    04970 Salivary secretion     125931555    04971 Gastric acid secretion     125931555   09156 Nervous system    04728 Dopaminergic synapse     125931555    04720 Long-term potentiation     125931555    04722 Neurotrophin signaling pathway     125931555   09157 Sensory system    04744 Phototransduction     125931555    04740 Olfactory transduction     125931555    04750 Inflammatory mediator regulation of TRP channels     125931555   09159 Environmental adaptation    04713 Circadian entrainment     125931555  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125931555   09162 Cancer: specific types    05214 Glioma     125931555   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125931555    05163 Human cytomegalovirus infection     125931555    05167 Kaposi sarcoma-associated herpesvirus infection     125931555   09171 Infectious disease: bacterial    05133 Pertussis     125931555    05152 Tuberculosis     125931555   09164 Neurodegenerative disease    05010 Alzheimer disease     125931555    05012 Parkinson disease     125931555    05022 Pathways of neurodegeneration - multiple diseases     125931555   09165 Substance dependence    05031 Amphetamine addiction     125931555    05034 Alcoholism     125931555   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125931555    05418 Fluid shear stress and atherosclerosis     125931555  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:puc01009]     125931555   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:puc04131]     125931555    03036 Chromosome and associated proteins [BR:puc03036]     125931555   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125931555 Protein phosphatases and associated proteins [BR:puc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      125931555 Membrane trafficking [BR:puc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     125931555 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      125931555 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    125931555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C EF-hand_9 EH AIF-1 FCaBP_EF-hand EFhand_Ca_insen DUF2750 COMMD1_N Motif Other DBs NCBI-GeneID:  125931555 NCBI-ProteinID:  XP_049499561 LinkDB All DBs Position X:complement(18773665..18774949) Genome browser AA seq 130 aa AA seqDB search MADEVTEEQIAEFKGAFSLLDKDGNGTITTKERRIVMRSWSQNPAGAKLQEMINDEVDAD ANGTIDFAEFLTAMARKMKDTSSEEEICEVFRVFYKDGNGYISVAELCRVMTNLGETLTD EEINDQRSRY NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggctgacgaggtgaccgaagaacagattgccgagttcaagggagccttctccctactt gacaaagatggcaatggcaccatcacaacaaaggaacgtagaattgtcatgaggtcatgg agtcagaacccagcaggagccaaattgcaggagatgatcaatgatgaggtggatgctgat gctaatggcaccattgacttcgcagaatttttgactgcaatggctagaaaaatgaaagat acaagcagtgaagaagaaatttgcgaagtgttccgagttttttacaaggatgggaatggt tatatcagtgtggcagaactatgtcgtgtcatgacaaacttaggagaaacactaacagat gaagaaataaatgatcagagaagtagatattga

DBGET integrated database retrieval system