Panthera uncia (snow leopard): 125932109 Help Entry 125932109         CDS       T08832                                  Name (RefSeq) histone H2A-Bbd type 2/3   KO K11251   histone H2A Organism puc  Panthera uncia (snow leopard) Pathway puc03082   ATP-dependent chromatin remodeling puc04217   Necroptosis puc04613   Neutrophil extracellular trap formation puc05034   Alcoholism puc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:puc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125932109  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125932109  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     125932109  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     125932109   09165 Substance dependence    05034 Alcoholism     125932109  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:puc03036]     125932109   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:puc04147]     125932109 Chromosome and associated proteins [BR:puc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125932109 Exosome [BR:puc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125932109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  125932109 NCBI-ProteinID:  XP_049500487 LinkDB All DBs Position X:121764461..121770613 Genome browser AA seq 114 aa AA seqDB search MPVRRSRRGSSGGQSRSAPALPARAELTFSVSHVERLLREGRYSQRLGASAPIFLAAVIQ SLTAKVLELAGIEARNRGRRLITPDVVDMVVHNHPLLSAFFQSTIISQAVPGWN NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgcctgtgaggaggagccgtcgagggtcgtccggtggccagagccggtccgctcccgca ctgcccgcccgagccgagttgacgttctccgtgagccacgtggagcgcctcctgcgggag ggccgctactcgcagcgcctgggcgcgtccgccccgatcttcctagcggccgtcatccag tccctgacggccaaggtcctggagctggccggcatcgaggcccggaacagaggcaggagg ctcatcaccccggatgtcgtggacatggtggtccacaaccacccgctgctcagcgccttc ttccagtccaccatcatctcccaggcggtcccgggctggaactag

DBGET integrated database retrieval system