Panthera uncia (snow leopard): 125932971 Help Entry 125932971         CDS       T08832                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism puc  Panthera uncia (snow leopard) Brite KEGG Orthology (KO) [BR:puc00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:puc03037]     125932971 Cilium and associated proteins [BR:puc03037]  Primary cilia and associated proteins   BBSome    125932971 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  125932971 NCBI-ProteinID:  XP_049501704 LinkDB All DBs Position D2:complement(65972994..65983764) Genome browser AA seq 70 aa AA seqDB search MAEVKSMFREVLPKQGQLSVEDITTMVLCKPKLLPLKSLTLEKLEKMQQAAQDTIRQQEM AEKEQQQITH NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcggaagtgaagtctatgttccgggaagtccttccaaaacaagggcagctgtctgtg gaagatataaccacaatggtgctgtgtaaacccaaacttttacccttaaaatctctgact ctggaaaaattggagaaaatgcagcaagcagcccaggatacgattcgccaacaagaaatg gcagaaaaggaacaacagcaaataactcactga

DBGET integrated database retrieval system