Panthera uncia (snow leopard): 125935483 Help Entry 125935483         CDS       T08832                                  Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04630   JAK-STAT signaling pathway puc04640   Hematopoietic cell lineage puc04657   IL-17 signaling pathway puc04658   Th1 and Th2 cell differentiation puc04660   T cell receptor signaling pathway puc04664   Fc epsilon RI signaling pathway puc04672   Intestinal immune network for IgA production puc05200   Pathways in cancer puc05310   Asthma puc05320   Autoimmune thyroid disease puc05321   Inflammatory bowel disease puc05330   Allograft rejection Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125935483   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125935483  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125935483    04660 T cell receptor signaling pathway     125935483    04658 Th1 and Th2 cell differentiation     125935483    04657 IL-17 signaling pathway     125935483    04664 Fc epsilon RI signaling pathway     125935483    04672 Intestinal immune network for IgA production     125935483  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125935483   09163 Immune disease    05310 Asthma     125935483    05320 Autoimmune thyroid disease     125935483    05321 Inflammatory bowel disease     125935483    05330 Allograft rejection     125935483  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125935483    00536 Glycosaminoglycan binding proteins [BR:puc00536]     125935483 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Interleukins    125935483 Glycosaminoglycan binding proteins [BR:puc00536]  Heparan sulfate / Heparin   Cytokines    125935483 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  125935483 NCBI-ProteinID:  XP_049505123 LinkDB All DBs Position A1 Genome browser AA seq 134 aa AA seqDB search MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH QLCIEEVFQGIDTLKNRTAPGDAVDKLFRNLSLIKEHIDLQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac caactgtgcattgaagaagtctttcagggtatagacacattaaagaatcgcactgcaccg ggggatgctgtggacaagcttttccgaaacttgtctttaataaaagaacacatagacctc caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system