Panthera uncia (snow leopard): 125935514 Help Entry 125935514         CDS       T08832                                  Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism puc  Panthera uncia (snow leopard) Pathway puc04060   Cytokine-cytokine receptor interaction puc04061   Viral protein interaction with cytokine and cytokine receptor puc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:puc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125935514    04061 Viral protein interaction with cytokine and cytokine receptor     125935514  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     125935514  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:puc04052]     125935514 Cytokines and neuropeptides [BR:puc04052]  Cytokines   Chemokines    125935514 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6355 NinB Motif Other DBs NCBI-GeneID:  125935514 NCBI-ProteinID:  XP_049505182 LinkDB All DBs Position A1 Genome browser AA seq 99 aa AA seqDB search MRLLSAALLLLLLALCAARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT KSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaggctcctgtccgccgcgctactcctgctgctcctggcgttgtgcgccgcacgcgtg gacgggtccaaatgtaaatgctcccgaaaggggcccaagattcgatacagcgacgtgaag aagctggaaatgaagccaaagtacccgcactgcgaggagaagatggttatcatcaccacc aagagcgtgtccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcacc aagcggttcatcaagtggtacaacgcctggaacgagaaacgcagggtctacgaagagtag

DBGET integrated database retrieval system